SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI06G00690.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI06G00690.1
Domain Number 1 Region: 9-564
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 9.55e-98
Family Acetyl-CoA synthetase-like 0.0000133
Further Details:      
 
Domain Number 2 Region: 788-1043
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.28e-32
Family Quinoprotein alcohol dehydrogenase-like 0.0075
Further Details:      
 
Domain Number 3 Region: 580-643
Classification Level Classification E-value
Superfamily ACP-like 0.0000081
Family Peptidyl carrier domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI06G00690.1
Sequence length 1106
Comment pep:novel chromosome:ALNW00000000:6:566390:576326:1 gene:OMERI06G00690 transcript:OMERI06G00690.1 description:""
Sequence
MAAAAKEEEPCCISHAFDRAARRNPTGLAVIHAASSSPSSGSDSERRFTCADLLAAVSTL
SRRIAAELRSSTSRHRDESPGCSGRPVEAAAAPRVVGVYASPSVEYIAAVLAVLRCGEAF
LPLDPSWPEERIRWATSSSNAALVVSSGGLGAAHVFASSACSVIRMDDDLWQVFEDEKGG
IGRDGLAWPCECKKPREFCYVMFTSGSTGKPKGVCGTEKGLLNRFLWMQRWKPLCSDDQL
LFKTSVSFVDHLQEFLSAVLTCTTLVIPPPNDWRANPASLANLIKAYGISRMTLVPSLME
IILPTLEKNLSWGHNPLKMLIFSGENLSILLWKRVHEILPETTIVNLYGTTEVSGDCTFF
DCTDLPILLKREELTSVPIGFPISNCEVCIATDAEVADEGEMHVTGACLFAGYLEESMAS
NHTEDNGSSTYYRTGDFARRLKSGEFIFLGRKDRTVKIYGQRFSLQEVESTLNEHPDVSA
AAVTFQNNGSLDFRAYLVLKSSTASVKDCQQRKRYKSSQVIMPSIRSWLIMKLPPAMIPR
FFLYMESLPLTSSGKIDYMKLSSLKCALESCETETERITVNPHLQVIKKAFSDALLVDEV
SEFDDFFTLGGNSISAAHVAHKLEIDMRMLYIYSTPSKLLDALFTKHGCLLSSSHEPHLK
KGLDISSSIHSSFNPIATSVDDNFPEVKAHINGDGECAHDAISGNYANEVDGQLNRNVPL
SNDRYQTKSLLLDTCSNDSIVDVSPWILNFCLQKKWSLGRCNRFMHGYEDKLQIEDVCSY
VPYNKRGYLQALWNIPLGSCVDASPLLVSNNGMLSIFIGSHSHTFLCIDGCSGSVRWNVK
LEGRVECSAAITGDFSEVVVGCYKGKIYFLDMLTGKQAWTIQTDGEVKMQPVVDMIRNLI
WCGSYDHHLYALNCKDRCCTYKISCGGSIYGSPAIDMTHNMIYVASTSGLVTAISLEVSS
FRIIWQYEAGAPIFGSLAIHHHGGKVICCLVNGLVVALNSHGSVVWKASVGGPIFAGACL
SSGLPTQVLIPSRDGILYSFDTVHVIRIRADAKEEKVNGSICNDLVQGFAAIDLPGDIFS
SPLMIGGRIFGYQAAAAYSSSAFLRL
Download sequence
Identical sequences OMERI06G00690.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]