SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI06G24960.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI06G24960.1
Domain Number 1 Region: 141-281
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-43
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 906-973
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000392
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI06G24960.1
Sequence length 1028
Comment pep:novel chromosome:ALNW00000000:6:30338080:30346669:1 gene:OMERI06G24960 transcript:OMERI06G24960.1 description:""
Sequence
MMKQAQQQQPPPASSAATTTAMAAAAAAAVVGSGCEGEKTKAPAINSELWHACAGPLVSL
PPAGSLVVYFPQGHSEQVAASMQKDVDAHVPSYPNLPSKLICLLHNVTLHADPETDEVYA
QMTLQPVTSYGKEALQLSELALKQARPQTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPP
LDFSMQPPAQELQARDLHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVIFVR
DEKQQLLLGIRRANRQPTNISSSVLSSDSMHIGILAAAAHAAANNSPFTIFYNPRASPTE
FVIPFAKYQKAVYGNQISLGMRFRMMFETEELGTRRYMGTITGISDLDPVRWKNSQWRNL
QVGWDESAAGERRNRVSIWEIEPVAAPFFICPPPFFGAKRPRQLDDESSEMENLLKRAMP
WLGEEICIKDPQTQNTIMPGLSLVQWMNMNMQQSSSFANTAMQSEYLRSLSNPNMQNLGA
ADLSRQLCLQNQLLQQNNIQFNTPKLSQQMQPVNELAKAGIPLNQLGVSTKPQEQIHDAS
NLQRQQPSMNHMLPLSQAQTSLGQAQLSNSQTLSQQQMMPQQSTKVPSQNTPLPLPVQQE
PQQKLLQKQAMLADTSEAAVPPTTSVNVISTTGSPLMTIGATHSVLTEEIPSCSTSPSTA
NGNRLLQPILGRNKHCSMINTEKVPQSAAPMSVPSSLEAVTATPRMIKDSPKLNHSVKQS
VVASKLANAGTGSQNYVNNPPPTDYLETASSATSVWLSQNDGLLHQNFPMSNFNQPQMFK
DAPPDAEIHAANTSNNALFGINGDGPLGFPIGLGTDDFLSNGIDAAKYENHISTEIDNSY
RIPKDAQQEISSSMVSQSFGASDMAFNSIDSTINDGGFLNRSSWPPAAPLKRMRTFTKVY
KRGAVGRSIDMSQFSGYDELKHALARMFSIEGQLEERQRIGWKLVYKDHEDDILLLGDDP
WEEFVGCVKCIRILSPQEVQQMSLEGCDLGNNIPPNQACSSSDGGNAWRARCDQNSGNPS
NGSYEQFE
Download sequence
Identical sequences OMERI06G24960.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]