SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI07G08500.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI07G08500.1
Domain Number 1 Region: 834-1056,1098-1317
Classification Level Classification E-value
Superfamily L domain-like 4.42e-36
Family Internalin LRR domain 0.051
Further Details:      
 
Domain Number 2 Region: 515-770
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.89e-36
Family G proteins 0.042
Further Details:      
 
Domain Number 3 Region: 346-501
Classification Level Classification E-value
Superfamily RNI-like 2.75e-24
Family Cyclin A/CDK2-associated p19, Skp2 0.015
Further Details:      
 
Domain Number 4 Region: 76-157
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-20
Family B3 DNA binding domain 0.00018
Further Details:      
 
Domain Number 5 Region: 1340-1393
Classification Level Classification E-value
Superfamily WRKY DNA-binding domain 0.00000000000000144
Family WRKY DNA-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI07G08500.1
Sequence length 1474
Comment pep:novel chromosome:ALNW00000000:7:9057960:9064357:-1 gene:OMERI07G08500 transcript:OMERI07G08500.1 description:""
Sequence
MEPGSSSREGEQQEQANERLTATGGGGGGGGPVSDQELSDGEEVSDGEYQAADDDVSGDH
QGGGDAARGRGFVEKEHMFDKVVTPRDVGNLDRLVIPRQHAQCYFPRDDCAGKPWRFLYS
YCGSSCSYVFTLGWSHFFRENRLNAGDTVSFYRGATDATRDRLFIDSKRQMHRINRLFQL
LVRVRTMVSSFGEAGSPSPAPPPNSPLPTLQNFTYKALKDCLQDLHYYNLLSLMGRNHTS
QSTPLRFAFGVDAKIRGTIPKLIALIQFQSLSLPDPVLGTPAAATLLSNCISLCRGVLGI
MGFLCSDENMKEDHWMLQVPAFDDLNYSAQDRITRMKEQTMPSSLSDPIYLLPTAIRNLM
YLDLSNCSDIVQLPPSLGSSLHKLSALNLSCCYSLRALPDSLVCLYDLQILLLSFCHNLQ
NLPVSFGDLSNLRLLDLSGCRSLRLLPDSFVNLGSLENLNLSDCIRLKGIPQSFGNLGKL
VNLRSLTLSQHNTDIKYFPYSFTDLRRHPYQSRWWKNNRSYRCLQQIIINRLLSDGFDEG
DITSEQSLTSICIFGESGTGKTELLHEIYNDQMILEGFHLRIWINMCDKKRLLEKIIEFT
TCAYCYDAPSSILEETVREELNGKRFLLVLNDADIEKQCFWTDVWKLANVGAAGSALIVT
TRSKEVASLFGAMKPCCMNPLSKEECFMVFQEHAGCGVDIYNYHELTEVGWKIVEKCGGN
LLCMKALSGLLFHSENALFEIDSLVGGIVPALRLCYDLLPSHLKQCFKFCSLFPKDYVFI
KHHIIQLWISQGFVYPEEDSQLEDTGLQYFNELFCRSFFQHCPFSNDHEDKFVVHELFHD
LARSVSKDESFSSEEPFFSLPENICHLSLVISDSNTVVLTKEHRRLQSLMVVRTSASEYS
SSFVPLLKILGLNDLLMKCEFLRALNLSCTTIVDLPGSIGRMKHLRFLAMNNTKIKNLPA
EIGQLNTLQTLELKDSCCLIELPESTKNLTKLRHLDVQKEPGNIHVGMPSGLGQLTDLQT
LTVFNIGDDLSHCSIRDLKNLSGLRGHVHITGLQNITAGDDAKEANLVGKQFLQALTLEW
CCCNEEMEDESDKEIANQVLQNLQPNTSIQELAIQNYPGNSFPNWIKDSGFCMLVSITID
NSQDCNEIPYLGDLPCLKFLFIQKMYAVENFGQRSNSLTTDGKHAPGFPSLEILNLWEMY
SLQFWNGTRYGDFPQLRHLSISRCPKLSNLPPLISLLYLSFHCGDQLPALSEFPSLKSLK
IEGFQKLKSVSFCPEMPMLQKLEISDCKELVSIDAPLLSVSNLKVVRCPKLHFGGSWLEG
CLMWEEFKRNKCTIKYLLVKTMKDDGWNWRKYGQKDILGSKYQRSYLRCNQMHSTGCKAR
KIVEPNNDDLNIWLPPVPPPRRPLAASPPPEPAAGNGREGGGGENILGEPFLGVGGGAAS
TGRWLTEAAVDGGGCDGSGHAGDGSDPPGRGWGR
Download sequence
Identical sequences OMERI07G08500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]