SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI08G07840.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI08G07840.1
Domain Number 1 Region: 341-386
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000353
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI08G07840.1
Sequence length 523
Comment pep:novel chromosome:ALNW00000000:8:8908005:8912972:-1 gene:OMERI08G07840 transcript:OMERI08G07840.1 description:""
Sequence
MSPPQDPPCDIAAAAVVVSPDPKSHHDGGDEDVDRPVQPPSAAVPANNPRRPVEIETSYY
VLMPVHELHGGAGGSGDRPPPKKRPATSGSCSGAVDDDSSPPSLPPKKRKVAVDYRVDSF
GGSGSRNRETPPAVTRHGGGGGAPAGSTAMDPALANELRRREIKFGKRKVKAEAALTAPI
TTKLPPREKLMHDGIRAAAAATPRLLPPPPPPLPAMNGQLHNDIVDNLSAELRELLDALG
ATAPRYVCTKSLKRSDVDLNQNRLLISCKQGEVFKCPITHLFTGEETIIVNKNPDETKET
KKKKKKKKKKKNKKRRNNDDNEEKEPGLKVKKKKNKNEEKERPGLKVTMLDHGGDTYATT
CRYLTSNGGYRFIGEWGKFLRNNGLAVCVNKGEEWTRSVHVKLLEFRSRRLPQADKSGHP
DGALGFVVLHGDNSDSDDGEDGPCKGKAPPPANAKKNKKKKKKKKSNSKEHVNATSSSSA
SASVAAERVTRSVEQEADDEDEWIQRAVNGMLKLHEGSQGEQQ
Download sequence
Identical sequences OMERI08G07840.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]