SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI10G13500.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI10G13500.1
Domain Number 1 Region: 32-132
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.79e-29
Family B3 DNA binding domain 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI10G13500.1
Sequence length 309
Comment pep:novel chromosome:ALNW00000000:10:16183740:16184669:-1 gene:OMERI10G13500 transcript:OMERI10G13500.1 description:""
Sequence
MEFTPISPPTRVAGGEEDSERAAAAWAVVEKEHMFEKVVTPSDVGKLNRLVIPKQHAERY
FPLDSAAAGGGGGGGGGGKGLVLSFEDRTGKAWRFRYSYWNSSQSYVMTKGWSRFVKEKR
LGAGDTVSFGRGLGDAARGRLFIDFRRRRQDAGGFMFPPTAAPPSHHHHHQRHHPPLPSV
PLCPWRDYTTAYGGGYGYGYGYGGGSTPAASSRHVLFLRPQVPAAVVLKSVPVHVAAASA
AVQEATTTRPKRVRLFGVNLDCPAAMDDDDVAGAASRTAASSLLQLPSPSSSTSSSTAGK
KMCSLDLGL
Download sequence
Identical sequences A0A0E0F0D4
OMERI10G13500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]