SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI11G04630.2 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI11G04630.2
Domain Number 1 Region: 266-366
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-25
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 22-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-20
Family B3 DNA binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI11G04630.2
Sequence length 381
Comment pep:novel chromosome:ALNW00000000:11:4277383:4285291:-1 gene:OMERI11G04630 transcript:OMERI11G04630.2 description:""
Sequence
MERHRNREAARSRREEERVVMVKIPSSFNQCLQNQPTGMVSLVDRSGNKWSAELTSDSEG
FFFVHGWKEFVRDNSIQCGQFLVFTYDKRSQFSVTVFEPSGIDKISTFSAHLSKNVIIKT
ESDEGGMVTAAITTEKMAPALKENNGITGKRTRDVDYLMEDRVVVFKKSSEANVCESSRR
KRAGASAGKSKVTSTSHNSTRGSSCSSDEDNSSSKSPNPPFLMRFLSGEVSRRGVSKGQR
QLTVISQRRPVTEAEKDHALQRAREFKSKNPFAVQIMMESYVYVGFFMNIPCEFVRECLP
RTNKRITLWDPQGKAWEVNYVYYSDRSVGSFSGGWGKFAVGNNLEKFDVCVFELVQKDNI
KVHIYRVVPEITPHKLRSDPK
Download sequence
Identical sequences A0A0E0F391
OMERI11G04630.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]