SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI11G12320.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI11G12320.1
Domain Number 1 Region: 151-285
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.02e-41
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 726-807
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000157
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI11G12320.1
Sequence length 859
Comment pep:novel chromosome:ALNW00000000:11:16482891:16489856:-1 gene:OMERI11G12320 transcript:OMERI11G12320.1 description:""
Sequence
MATAEVGGGGGGEGDAAAAAVARAGGGGGGGGGGGGGGGGGEDALFTELWSACAGPLVTV
PRVGEKVFYFPQGHIEQVEASTNQVGEQRMQLYNLPWKILCEVMNVELKAEPDTDEVYAQ
LTLLPESKQQEDNGSTEEEVPSAPAAGHVRPRVHSFCKTLTASDTSTHGGFSVLRRHADE
CLPPLDMSRQPPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAF
IFLRGENGELRVGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPRT
SPAEFVVPYDRYMETLKRNYSIGMRFKMRFEGEEAPEQRFTGTIVGMGDSDPAGWPESKW
RSLKVRWDEASSIPRPERVSPWQIEPAVSPPVNPLPVPRTKRLRPNATALPADSSAIAKE
AATKVVVESEPNGTQRTFQTQENATPKSGFGNSSKLESAQKSIMRPSGFDREKNNTPIQW
KLGSDGRMQMRRPESYSEMLSGFQPPKDVQTPQGFCSLPEQITAGHSNFWHTVNAQYQDQ
QSNRNMFPSSWSFMPPNTGLGLNKQNYSMIQEVGGLSQRHGNTKFGNGVYAALPGRGTEQ
YSGGWFGHMMPNSHMDDTQPCLIKPKPLVVAHGDVQKAKGASCKLFGIHLDSPAKSEPLK
SPSSVVYDGTPQTPGATEWRRPDVTEVEKCSDPSKAMKPLDTPQADSVPEKPSSQQASRN
MSCKSQGVSTRSCKKVHKQGIALGRSVDLTKFNGYEELIAELDDMFDFNGELKGPKKEWM
VVYTDNEGDMMLVGDDPWIEFCDMVHKIFIYTRDEVQRMNPGTLNSRSEDSHANSMERGS
VGREMRGCLSTSSLNSENC
Download sequence
Identical sequences A0A0E0F680
OMERI11G12320.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]