SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI11G15210.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI11G15210.1
Domain Number 1 Region: 99-154
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000863
Family B3 DNA binding domain 0.011
Further Details:      
 
Weak hits

Sequence:  OMERI11G15210.1
Domain Number - Region: 24-90
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0498
Family CAC2371-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI11G15210.1
Sequence length 157
Comment pep:novel chromosome:ALNW00000000:11:19894753:19895550:1 gene:OMERI11G15210 transcript:OMERI11G15210.1 description:""
Sequence
MNHRSVQTSIFLFFTLYILVPFANIAYQLQSIFDRTTKREFKDLCFCAKNVEVTSDIKNY
IKDIEQFLSHSGKFYNVTINTTFMEQDRIKYIQPLMEGKKTINIQVQTAGNDSTTMVLHV
STDGRCSLKKGWTNFAVQNNIHLQSICIFHFYKAAHI
Download sequence
Identical sequences OMERI11G15210.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]