SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI12G01720.2 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI12G01720.2
Domain Number 1 Region: 82-177
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-30
Family B3 DNA binding domain 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI12G01720.2
Sequence length 382
Comment pep:novel chromosome:ALNW00000000:12:1399017:1400892:-1 gene:OMERI12G01720 transcript:OMERI12G01720.2 description:""
Sequence
MHGSLHNTPSSSSSPTSSPLLSSPPLPNFCSQHIFVSIDRSISSSSAAAMAMHPLAQGHP
QAWPWGVAMYTNLHYHHHYEREHLFEKPLTPSDVGKLNRLVIPKQHAERYFPLGGGDSGE
KGLLLSFEDESGKPWRFRYSYWTSSQSYVLTKGWSRYVKEKRLDAGDVVHFERVRGLGAG
DRLFIGCRRRGESAPAPPAPPAVRVTPPPALNGGEQQPWSPMCYSTSGSSYDPTSPANSY
AYHRSVDQDHSDILHAGESQRDTDAKSSSAASAPPPSRRLRLFGVNLDCGPEPEADQATA
MYGYMHHQSPYAAGQLVDEMRRSEAFACRILTTNSETSYYYHHYYYYTLNQVTVCDCEWV
HEQTVKLMYPSPAASPEPEETK
Download sequence
Identical sequences OMERI12G01720.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]