SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI12G05660.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI12G05660.1
Domain Number 1 Region: 450-647,712-783
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000425
Family Polygalacturonase inhibiting protein PGIP 0.033
Further Details:      
 
Domain Number 2 Region: 332-401
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000011
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI12G05660.1
Sequence length 848
Comment pep:novel chromosome:ALNW00000000:12:6558117:6567258:-1 gene:OMERI12G05660 transcript:OMERI12G05660.1 description:""
Sequence
MAGAIVSASVGVLNPLLTKLSSLIKGEYKLLKSVKKDIIFLRNELSSISVLLEHLSNKED
KLDGPTMEWRNNMLELAYDIEDCIDLFIHKLSCGDANANFVRKIGSKIKKLWGKHQITEC
IQELKNRVMEEDQRRKRYQIDDFISEPSMVEIDPRLLALYEEVERLVGIDGPREKIVKKV
LVDMLKGLGSNGDVSEDEQNLISHLRGFLKDKRNRSNILQIKSRSNTTTSFGEKLNPKSA
REPYSGVERQGGLVELNGERPAIGVSSAMAGKAALGRQRGSSSMSDATAAEDTEDCSATS
LMPGSKKEEGKGEMGGVVRSFSTQFAEFEAFSIPFSEQYINEHLPIEDLLVTVVGSTVSY
PMRLMKSKDKQATFTTGWNKLVGDKLFELCDVCVFMFSENDAELTLSLELLNNCSMRRRR
GSFDAPKKWAAQTNSLLAEWAYDGSAKYCRVHDIVLDLIISLSTGQNFVAIVDEQQHWSS
FKKIRRTWFPSNGTDNRIVKKITNNCSQVRSLLFFENPKPKQIPQFKKCHALRLKYLKVF
GVNVTELPKDIGRLQQLETLTIHAGDVDEINIPSSVCRLQKLQRLNFNYPMRLPDEIGVL
QALEVLYLNSIRYSIKCLQELCWLTRLRQLRILCPGIYDFGGDVARFQRYKEAFYFTLNE
LVVLQISKSFLLMAMEYLNFRIGWSPFVILPLFVSGILQALIRKWSSSLGIPKLLYLEVF
LSRGLGDGLTVGCIACIGCCLNLELCPKLQRLCFSLYAREAASNLGLEQSYVHLSSLQHL
TFYLCCTNATITDVKAVEASIRNVISIHTRRPTLVLRRYLQDRMVKEDEEEQLKDSTDGC
GVEEHHIQ
Download sequence
Identical sequences A0A0E0FB44
OMERI12G05660.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]