SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI12G08370.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI12G08370.1
Domain Number 1 Region: 139-294
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.79e-36
Family B3 DNA binding domain 0.0057
Further Details:      
 
Domain Number 2 Region: 732-806
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000589
Family PB1 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI12G08370.1
Sequence length 858
Comment pep:novel chromosome:ALNW00000000:12:12247583:12253623:-1 gene:OMERI12G08370 transcript:OMERI12G08370.1 description:""
Sequence
MAAAATASPVEGLTGGGGGGGGGVDGLFVELWRACAGPLVTVPAVGERVFYLPQGHIEQV
EASTNQVAEQQGAPLYNLPWKIPCKVMNVELKAEPDTDEVYAQLTLLPEKQQDGNGSGNG
NASKDKVEEEEVVPPAATERPRVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLYSFFD
RLIVAMPLTTLLDQDMSQHPPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSA
KRLVAGDAFIFLRGENGELRVGVRRAMRQQANIPSSVISSHSMHLGVLATAWHAVNTGTM
FTVYYKPRTSPSEFVVPRDLYEESLKRNHSIGMRFKMTFEGEEAAEQRFTGTIVGVGDSD
PSGWADSKWRSLKVRWDEAASVPRPDRVSPWQIEPANSPSPVNPLPAPRTKRARPNVLAS
SPDLSAVNKEVASKVMANSQQNGLPRAFHSQENMNLRSRFGDSNELNTSQKLTMWSSGSN
QEKNNASVQRELGSQSWMQMRRPDGSSEILSGFQPLKDTRNPLSSFPSQISGNRSNKWNT
INVHYPDQNANHNMYPGTWSLMPPNTGFGLNQQNYLMTPDITLPQRSLNAKFGGNGAFTS
LRAHGIDQRSSGWLGHIEPSSHIDDASSSLIKPQPLVIDHNVQKAKGSSCMLFGISLDSP
AKPELLISPPSVAFDGKLQQDALEEDECSDPSKTLKPLDGAQHDSATEKHQSCPDGTKNI
QSKQQNGSSRSCKKVHKQGIALGRSIDLTKFTCYDELIAELDQMFDFNGELNSSSKNWMV
VYTDNEGDMMLVGDDPWNEFCNMVHKIFIYTREEVQKMNPGALNSRSEDSRSTSVERGLV
GEGLQGGLSTPSLNSENC
Download sequence
Identical sequences A0A0E0FC61
OMERI12G08370.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]