SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI12G12100.2 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI12G12100.2
Domain Number 1 Region: 716-814
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.49e-21
Family B3 DNA binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 46-145
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-21
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 3 Region: 249-348
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.39e-20
Family B3 DNA binding domain 0.0025
Further Details:      
 
Domain Number 4 Region: 1417-1517
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.44e-20
Family B3 DNA binding domain 0.0067
Further Details:      
 
Domain Number 5 Region: 1076-1182
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-18
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 6 Region: 1197-1300
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-17
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 7 Region: 925-1024
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.35e-16
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 8 Region: 583-685
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000012
Family B3 DNA binding domain 0.0081
Further Details:      
 
Domain Number 9 Region: 457-560
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000118
Family B3 DNA binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI12G12100.2
Sequence length 1530
Comment pep:novel chromosome:ALNW00000000:12:16876526:16892215:1 gene:OMERI12G12100 transcript:OMERI12G12100.2 description:""
Sequence
MMNSTPCGHEGSMPYHDNHVQSPSERRSMSHTLCMECTASYYWHNMKKRHFFIVMMDVGD
FQNELTIPKMFAKNVQGQISGVAKLEVPDGRTYDVEIAKEHNELVFRSGWEVFASAYELE
QGDILVFAYSGNSHFKVQIFNPSNCEKELSCVMMNRSISDDNHRQSPSWESLVPASRRRR
SPPACRLTAPLPASQHAAYLQAAPPPATAVRINVALKFIIVYPPDNDRWMNKSGTTCMDC
ITNHYWLHMDDRERYFFKVMMSVSDIKDELAIPKKFTANVRGKIPEQVRLEVSDGKMYNV
QVTEEQDELVLRSGWANFASTYQLKHGDLLVFIHSGHSHFKVLIFDPSYTEKEFSCVVTD
STSHVHERSISHDNHLQSPRSVILGKNYSLCSSRKRSRMNPADYPSQRPDVPSSEDIKDP
MSSGGLQKSKKSCYVLPMLYSMTSAQEAEVLALEKKIQPQIPLYITAMDISVASGSLVFS
KDYAVRYLLDQNRTIKLCQSGGSKTWDISLDMDTDDLYALSTGWLDFFRGNLLQEGDICV
FEASKSKRGVALTFHPFKESHCPKSSEYTLSTKSPTRRVPKRDYFATNLTNLTDQQERKC
FSVKYASKYLPHEDQNMRLRLPETKYKCKAALRVDTSTNLHKLLKGWGKFVNDNKLEVHD
ICLFQLMKNKKKLTMTVHIIRKGECSGSLCCRCCGMEKSHRVCKNCVANHYWLHMDNHGK
SFIKVMITDFKNGVTIPAKFARNFGGQMSGTVKLETRNGKTYEVQVAKELNNLVLRSGWE
RFASAYELEKGDILVFIQSGNSHFKVWIYDPSACEKELPCIITEQLPRVQQRSISHDNHT
RLKRNAKSAKLYVDSSGHTKETSEINPASSPSWKPTERVPFSEELDEPVDLANVQKATKS
FYSLPRMCNLTSAQKAEVDALEKRIKPQIPFYITVIDKASATDGLLAISKDYAVSYLLDK
NETIKLCHSGRSLTWDIGLDIDTDDQYALSTGWLDFIRNNHLQEGDICVFEASKNKRGVA
LIFHPLKQSHHPKPPGCVPSTKFPRHGVSKPNYIVSRFTTLSGQLKIKVEAKVQAIQSEV
PIFVAVMRESFIRGRSRYMCFSAKYAAKYLPRENNKIMRLRLPKKSYKYKAVFKINNKVH
KLGGGWGKFVDDNKLKLGDICLFQLMKDKKKLTMMVMGEKGCESCRKWQEHYYKEHMDVS
RIRFFRLMTGDFAHGISIPEKVAEIFSGQITKGFNLKSPSGETWRVGIEKVADELILMSG
WEDFAKAHELQENDLLFFTCNGHGNGSCSFDVLIFDASGCEKVSCFFTGKKNSYMCKNFN
SIGGQIAGKYLSSDSEDTSTPSVLIGSPHKASTSKKLSGKTKTNPRKEPEDPNCSHWHVI
EEKNTDDDEHADYHYTRFANYLTGEERDEIFSLVSLQPGNPVFVAVLQTAHVRRRNILIV
PTRFAADHLERKSHDILLIRPNRKQKWSVKYYYLSNTTRGFNCHRWIKFIRENRLREGNV
CIFELMKGARRPTMTVHVICKADNRFVLLS
Download sequence
Identical sequences OMERI12G12100.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]