SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI12G12130.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI12G12130.1
Domain Number 1 Region: 32-133
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-18
Family B3 DNA binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 246-348
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-17
Family B3 DNA binding domain 0.022
Further Details:      
 
Weak hits

Sequence:  OMERI12G12130.1
Domain Number - Region: 125-176
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 0.0687
Family Phycoerythrin 545 alpha-subunits 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI12G12130.1
Sequence length 358
Comment pep:novel chromosome:ALNW00000000:12:16921403:16923267:-1 gene:OMERI12G12130 transcript:OMERI12G12130.1 description:""
Sequence
MKFADKNAGEVMGEKGCESCSKWQEHYYREHIDVSRICFFRLMTGDFANRISIPEKFAKD
FNGHITKGLNLKASSCGTWRIGIEKVTGELFLKSGWDNFAKAHELKENDLLFFTCNGEGS
CSFDVLIFDASGCEKVPGVLTGKKDSHMCKHFSNVGGQNDEHYILIDSEDTSTPSYPVGS
HKASTSKNTNGKTKTNPSKERGNVKKEMIEEEESDDDEHVDYYYSRFANYLTCEERDEIF
SLVSLQPGNPVFVTVLRAGHVHRKNILIIPSGLAANHLDRKSHEILLIRSNRKEKWYVKH
YHANTTRGFNCHRWFKFIDENRLREGYVCIFELMKGAKRPTMTVHVIGKIDNQFVLLG
Download sequence
Identical sequences A0A0E0FDN0
OMERI12G12130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]