SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529234407|ref|YP_008395219.1| from Enterococcus faecium Aus0085

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529234407|ref|YP_008395219.1|
Domain Number 1 Region: 792-1170
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.18e-124
Family PFOR PP module 0.00000000884
Further Details:      
 
Domain Number 2 Region: 417-662
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.24e-81
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000178
Further Details:      
 
Domain Number 3 Region: 3-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.15e-72
Family PFOR Pyr module 0.0000000178
Further Details:      
 
Domain Number 4 Region: 259-413
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.71e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000275
Further Details:      
 
Domain Number 5 Region: 669-833
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.77e-23
Family Ferredoxin domains from multidomain proteins 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529234407|ref|YP_008395219.1|
Sequence length 1230
Comment pyruvate flavodoxin oxidoreductase subunit alpha [Enterococcus faecium Aus0085]
Sequence
MRKMKTMDGNTAAAYISYAFTEIAAIYPITPSSTMAELVDQWSAAGKENVFGQPVKVVEM
QSEAGAAGVVHGSLKTGALTTTYTASQGLLLMIPNMYKIAGELLPSVFHVASRAVTTNAL
NIFGDHGDVMAARQTGFAMLAESSVQEVMDLAPVAHLASIEGEVPFLNFFDGFRTSHEIQ
KIEVLEYEELAPLINQEKLASFRKRGMNPNHPTVSGTNQNPDIHFQQRETINPYYDKLPE
IVQKYMKEINRLRGTSYDLVTYYGADDAEEVIVSMGSVAQTIEQTIDYLNANGRKTGFLN
IHLYRPFPVETFVQKLPHTVKTIAVLDRSKEPGAGGEPLLLDVQSALYDSELRPAVIGGR
YGLGSKDVTPDQISAVFDELKKDPSIRKKRFTIGIVDDVTYQSLEPKESLDLTEPQTFQA
KFWGFGSDGTVGANKSAIKIIGDHTDKYAQGYFYYDSKKSGGLTVSHLRFGDTPIRSAYL
VEHADLVACHTPAYLHSYDLVKGLKPGGIFLLNTLWSDEQLETHLPLKLKRYLAENNIRF
YTINAMRLAQEVGLGRRINTAMETAFFKLADIIPFDEVLPLLKEEALKSYGHKSMAIVEK
NIQAIDRTTELLHQVAIPDHWRTLEMPEKINKRNTGYIQEILEPVNAQEGNQLSVGTLVA
NGMTTGEMPLGTASMEKRGVALEVPEWISDRCTMCNECAFVCPHAAIRPFLADEEEMEEA
PEGFIVREMRGADGVKYRIQVSVEDCTGCGLCVEACPAKEKALVMKPYEEQKEQAVNWAF
AMTLRQKANPVKGKNTVLSTQFNQPLLEFSGACSGCGETPYVKLLTQMFGDRMMIANATG
CSSIWGGASPASPYTTNECGQGPAWSNSLLEDNAEFGYGMLLAAQTRREALASSIKEVLP
KVSEELRELMEDWLVHMFESEGTQQRAAKLQAAIESERSIFPELEDIYKRKDLFVKNSQW
MIGGDGWAYDIGFGGIDHVLASGADVNILVLDNEVYSNTGGQTSKATPASAIAKFSASGK
YASKKDLGMMAMTYGNVYVAQIASGANQMQTIKAFEEAEKYPGPSLIIAYTPCITHGLLG
GMKESLKEAKEAVSSGYWSLYRYNPTMVEKNKNPMTLDYKKPDFSAMPDFMRKQVRFSSL
DNANPNLAKALFEKTVHDAKTRFYNYAALTGELEKIKKRLEPEESIDVPVKTRKEKTTDL
EAEERRAARRAARAERRKKMEQATKEKKEK
Download sequence
Identical sequences A0A0M1X996 A0A133CN86 J6PPR2 Q3Y0D0 T4JDF3
WP_002287819.1.100328 WP_002287819.1.100428 WP_002287819.1.100439 WP_002287819.1.100544 WP_002287819.1.101134 WP_002287819.1.101415 WP_002287819.1.101637 WP_002287819.1.101870 WP_002287819.1.10354 WP_002287819.1.10519 WP_002287819.1.10650 WP_002287819.1.11423 WP_002287819.1.11547 WP_002287819.1.11704 WP_002287819.1.11830 WP_002287819.1.12178 WP_002287819.1.12708 WP_002287819.1.13631 WP_002287819.1.13694 WP_002287819.1.13905 WP_002287819.1.1455 WP_002287819.1.14727 WP_002287819.1.14760 WP_002287819.1.15013 WP_002287819.1.15070 WP_002287819.1.15101 WP_002287819.1.15144 WP_002287819.1.15198 WP_002287819.1.16712 WP_002287819.1.16827 WP_002287819.1.17488 WP_002287819.1.17607 WP_002287819.1.17636 WP_002287819.1.17742 WP_002287819.1.17764 WP_002287819.1.17898 WP_002287819.1.17916 WP_002287819.1.18622 WP_002287819.1.18700 WP_002287819.1.1878 WP_002287819.1.19482 WP_002287819.1.19499 WP_002287819.1.19582 WP_002287819.1.19672 WP_002287819.1.19708 WP_002287819.1.19916 WP_002287819.1.20098 WP_002287819.1.201 WP_002287819.1.20896 WP_002287819.1.21659 WP_002287819.1.22311 WP_002287819.1.23055 WP_002287819.1.23063 WP_002287819.1.23147 WP_002287819.1.23327 WP_002287819.1.23414 WP_002287819.1.23429 WP_002287819.1.23691 WP_002287819.1.23697 WP_002287819.1.23712 WP_002287819.1.23774 WP_002287819.1.238 WP_002287819.1.24193 WP_002287819.1.24789 WP_002287819.1.25011 WP_002287819.1.25014 WP_002287819.1.25113 WP_002287819.1.25133 WP_002287819.1.25521 WP_002287819.1.25648 WP_002287819.1.2628 WP_002287819.1.26478 WP_002287819.1.26559 WP_002287819.1.26561 WP_002287819.1.2657 WP_002287819.1.26860 WP_002287819.1.26937 WP_002287819.1.27035 WP_002287819.1.2733 WP_002287819.1.27429 WP_002287819.1.27702 WP_002287819.1.28012 WP_002287819.1.28262 WP_002287819.1.2864 WP_002287819.1.29053 WP_002287819.1.29345 WP_002287819.1.29432 WP_002287819.1.30001 WP_002287819.1.30069 WP_002287819.1.30223 WP_002287819.1.31003 WP_002287819.1.31636 WP_002287819.1.31923 WP_002287819.1.32195 WP_002287819.1.3313 WP_002287819.1.33173 WP_002287819.1.33231 WP_002287819.1.33273 WP_002287819.1.33323 WP_002287819.1.3352 WP_002287819.1.34020 WP_002287819.1.34221 WP_002287819.1.34354 WP_002287819.1.34691 WP_002287819.1.34980 WP_002287819.1.35140 WP_002287819.1.35158 WP_002287819.1.35212 WP_002287819.1.35456 WP_002287819.1.36428 WP_002287819.1.36777 WP_002287819.1.37151 WP_002287819.1.37318 WP_002287819.1.37552 WP_002287819.1.37630 WP_002287819.1.38191 WP_002287819.1.38331 WP_002287819.1.38458 WP_002287819.1.38915 WP_002287819.1.38981 WP_002287819.1.39565 WP_002287819.1.39617 WP_002287819.1.40180 WP_002287819.1.4026 WP_002287819.1.40514 WP_002287819.1.4099 WP_002287819.1.41051 WP_002287819.1.41285 WP_002287819.1.41320 WP_002287819.1.41509 WP_002287819.1.4198 WP_002287819.1.4200 WP_002287819.1.42529 WP_002287819.1.43692 WP_002287819.1.44098 WP_002287819.1.44952 WP_002287819.1.45529 WP_002287819.1.45650 WP_002287819.1.45710 WP_002287819.1.45735 WP_002287819.1.45899 WP_002287819.1.46020 WP_002287819.1.46063 WP_002287819.1.46230 WP_002287819.1.46452 WP_002287819.1.46516 WP_002287819.1.46544 WP_002287819.1.46658 WP_002287819.1.46917 WP_002287819.1.47031 WP_002287819.1.47169 WP_002287819.1.47481 WP_002287819.1.47528 WP_002287819.1.47841 WP_002287819.1.47945 WP_002287819.1.48041 WP_002287819.1.48409 WP_002287819.1.48679 WP_002287819.1.491 WP_002287819.1.49384 WP_002287819.1.49395 WP_002287819.1.49529 WP_002287819.1.50124 WP_002287819.1.50286 WP_002287819.1.50809 WP_002287819.1.51584 WP_002287819.1.5159 WP_002287819.1.51612 WP_002287819.1.51972 WP_002287819.1.52239 WP_002287819.1.5246 WP_002287819.1.52683 WP_002287819.1.5286 WP_002287819.1.52912 WP_002287819.1.54270 WP_002287819.1.54461 WP_002287819.1.54852 WP_002287819.1.54853 WP_002287819.1.55260 WP_002287819.1.55308 WP_002287819.1.55462 WP_002287819.1.55697 WP_002287819.1.56694 WP_002287819.1.56838 WP_002287819.1.56895 WP_002287819.1.5700 WP_002287819.1.58120 WP_002287819.1.58377 WP_002287819.1.58779 WP_002287819.1.58804 WP_002287819.1.58928 WP_002287819.1.60393 WP_002287819.1.60535 WP_002287819.1.60821 WP_002287819.1.61331 WP_002287819.1.61826 WP_002287819.1.62072 WP_002287819.1.62179 WP_002287819.1.62385 WP_002287819.1.62582 WP_002287819.1.62626 WP_002287819.1.62930 WP_002287819.1.63121 WP_002287819.1.6344 WP_002287819.1.63994 WP_002287819.1.64083 WP_002287819.1.64252 WP_002287819.1.64454 WP_002287819.1.64934 WP_002287819.1.65170 WP_002287819.1.65360 WP_002287819.1.65424 WP_002287819.1.65502 WP_002287819.1.66419 WP_002287819.1.66493 WP_002287819.1.67323 WP_002287819.1.67518 WP_002287819.1.68042 WP_002287819.1.68129 WP_002287819.1.68536 WP_002287819.1.6855 WP_002287819.1.68836 WP_002287819.1.69084 WP_002287819.1.69201 WP_002287819.1.69436 WP_002287819.1.69533 WP_002287819.1.69633 WP_002287819.1.69942 WP_002287819.1.70021 WP_002287819.1.70109 WP_002287819.1.7025 WP_002287819.1.70405 WP_002287819.1.70468 WP_002287819.1.70482 WP_002287819.1.71049 WP_002287819.1.7137 WP_002287819.1.71593 WP_002287819.1.72110 WP_002287819.1.72273 WP_002287819.1.72658 WP_002287819.1.72952 WP_002287819.1.73179 WP_002287819.1.73250 WP_002287819.1.73552 WP_002287819.1.73997 WP_002287819.1.74527 WP_002287819.1.74707 WP_002287819.1.74749 WP_002287819.1.75235 WP_002287819.1.75278 WP_002287819.1.75417 WP_002287819.1.75579 WP_002287819.1.75619 WP_002287819.1.75916 WP_002287819.1.762 WP_002287819.1.76647 WP_002287819.1.76730 WP_002287819.1.77231 WP_002287819.1.7734 WP_002287819.1.77560 WP_002287819.1.77772 WP_002287819.1.78190 WP_002287819.1.78271 WP_002287819.1.78770 WP_002287819.1.78882 WP_002287819.1.7911 WP_002287819.1.80031 WP_002287819.1.80073 WP_002287819.1.80369 WP_002287819.1.80377 WP_002287819.1.80413 WP_002287819.1.81011 WP_002287819.1.81222 WP_002287819.1.81451 WP_002287819.1.81636 WP_002287819.1.81642 WP_002287819.1.81958 WP_002287819.1.82658 WP_002287819.1.82689 WP_002287819.1.82745 WP_002287819.1.83170 WP_002287819.1.83362 WP_002287819.1.83532 WP_002287819.1.83571 WP_002287819.1.8382 WP_002287819.1.83927 WP_002287819.1.84089 WP_002287819.1.84223 WP_002287819.1.84281 WP_002287819.1.84327 WP_002287819.1.85251 WP_002287819.1.85358 WP_002287819.1.85739 WP_002287819.1.8634 WP_002287819.1.86409 WP_002287819.1.86565 WP_002287819.1.86884 WP_002287819.1.87018 WP_002287819.1.87657 WP_002287819.1.87906 WP_002287819.1.87908 WP_002287819.1.88005 WP_002287819.1.88323 WP_002287819.1.88325 WP_002287819.1.88637 WP_002287819.1.88691 WP_002287819.1.89031 WP_002287819.1.89062 WP_002287819.1.89307 WP_002287819.1.89323 WP_002287819.1.89356 WP_002287819.1.89538 WP_002287819.1.89566 WP_002287819.1.89774 WP_002287819.1.89778 WP_002287819.1.90494 WP_002287819.1.9065 WP_002287819.1.9080 WP_002287819.1.91050 WP_002287819.1.9126 WP_002287819.1.91657 WP_002287819.1.91805 WP_002287819.1.91962 WP_002287819.1.92197 WP_002287819.1.92343 WP_002287819.1.92566 WP_002287819.1.9257 WP_002287819.1.93128 WP_002287819.1.93166 WP_002287819.1.93591 WP_002287819.1.93831 WP_002287819.1.93941 WP_002287819.1.9415 WP_002287819.1.94197 WP_002287819.1.94314 WP_002287819.1.94583 WP_002287819.1.94632 WP_002287819.1.94846 WP_002287819.1.95510 WP_002287819.1.95538 WP_002287819.1.96927 WP_002287819.1.96948 WP_002287819.1.97766 WP_002287819.1.98228 WP_002287819.1.98407 WP_002287819.1.98720 WP_002287819.1.98772 WP_002287819.1.9881 WP_002287819.1.98815 WP_002287819.1.98831 WP_002287819.1.98845 WP_002287819.1.98940 WP_002287819.1.99032 WP_002287819.1.9913 WP_002287819.1.9948 YP_006376234.1.11553 gi|389868811|ref|YP_006376234.1| gi|529234407|ref|YP_008395219.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]