SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529234445|ref|YP_008395257.1| from Enterococcus faecium Aus0085

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529234445|ref|YP_008395257.1|
Domain Number 1 Region: 20-96
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000135
Family TK-like Pyr module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|529234445|ref|YP_008395257.1|
Sequence length 294
Comment D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase [Enterococcus faecium Aus0085]
Sequence
MLTQHFKWMRKSHDLSWRNDYPSLNLIASSTVFQQDHNGYSHQDPGILTHLAEKKAEFIR
EYLPADANTLLAVMDKAFRSSEKINLIISSKHPRAQFYSAEEAAVLVNEGLKIIDWASTA
KEEEPELVIAAAGTESNLEALAAVTLLLEEFPKLKIRFINVVDLLKLRHPSQDPRGLSDE
EFDQYFTKDKPILFAFHGYETLVRTIFFDRHNHHLMIHGYKENGDITTPFDMRVVNELDR
YHLAKDAALKIKGSQAEDFAKKMDQKLQEHQNYIRENGIDLPEVLDWKWKNLDQ
Download sequence
Identical sequences A0A0M1X9V3 A0A1S8KSG8 I3U2Q4 J6Q8Y7
gi|389868851|ref|YP_006376274.1| gi|383329030|ref|YP_005354914.1| gi|529234445|ref|YP_008395257.1| YP_006376274.1.11553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]