SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529235393|ref|YP_008396205.1| from Enterococcus faecium Aus0085

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529235393|ref|YP_008396205.1|
Domain Number 1 Region: 27-243
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.29e-58
Family PP-loop ATPase 0.00014
Further Details:      
 
Domain Number 2 Region: 392-447
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000016
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529235393|ref|YP_008396205.1|
Sequence length 484
Comment tRNA(Ile)-lysidine synthase [Enterococcus faecium Aus0085]
Sequence
MERMNVEKGGKKAPLLQQSFIRHGNEQGFWQQGSRILAAVSGGVDSMVLLHLLLQVQRQI
GFSLGIVHINHQLREESAEEAAYLRSYCEEKNLPLYVSIWEDPAKSAIETEARNFRYQEF
TRVMEEGQYDTLMTAHHGDDQIETVLMKIVRGGQLNTFSGIKEVQPFATGRLIRPLLSFS
KEDLYTYAAESQLVYFEDQTNQLLDIQRNRLRHLVVPQLKQENTQALRHFQQFSQQIQWA
DQVIQKYMGQLIEKEVEQWEEQFRFSAEMIEEMTDAERYYFFYSFFDKAFSKTGIILKEQ
QMESILDQWQQKKSQWQLSIGNNWILKREYHFVVLSKKEKQATSQTEDQRLLLIPEQGIY
LNETEWIGLVKPENAGDIKATDSWSLFSHDIWIPADVQLYVEKRKAGDRIKLTENLTKKV
SRYFIDQKVPNSQRQHAWIITDAKRNIYSLIPFAFSYLSIREETDKIHYILLYKYQKEAI
GRRT
Download sequence
Identical sequences A0A1A7S5X1 D4RHW9 U2Q9V0 U7TVB6
gi|383329915|ref|YP_005355799.1| gi|529235393|ref|YP_008396205.1| gi|447913801|ref|YP_007395213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]