SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trias1|31799|gm1.9768_g from Trichoderma asperellum CBS 433.97 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trias1|31799|gm1.9768_g
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Pre-PUA domain 9.15e-33
Family Nip7p homolog, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 97-172
Classification Level Classification E-value
Superfamily PUA domain-like 2.8e-22
Family PUA domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trias1|31799|gm1.9768_g
Sequence length 185
Sequence
MRPLTEEETQAVFKKLAEYTGASLKNIIAPQEDGDRNVFRLSQNRVYVVRLSMANLATSI
ARDNLLSLGTCLGKFTKSGKFRIHITALPILAEHARHKLWIRPNGVMPFLYGGNIVKAHV
GRFSEDCPEHQGLVVYTMDDVPLGFGVSARSTAESRRLDPTGVVCFRQADCGEYLRDEDT
LFQSG
Download sequence
Identical sequences A0A0W7VXE9 G9NI45
XP_013947625.1.20613 XP_018664147.1.75393 jgi|Trias1|31799|gm1.9768_g jgi|Triat1|156634|estExt_Genewise1Plus.C_130190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]