SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564954188|ref|YP_008886758.1| from Pseudomonas aeruginosa MTB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564954188|ref|YP_008886758.1|
Domain Number 1 Region: 26-210
Classification Level Classification E-value
Superfamily E set domains 1.01e-54
Family E-set domains of sugar-utilizing enzymes 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|564954188|ref|YP_008886758.1|
Sequence length 389
Comment chitin-binding protein [Pseudomonas aeruginosa MTB-1]
Sequence
MKHYSATLALLPLTLALFLPQAAHAHGSMETPPSRVYGCFLEGPENPKSAACKAAVAAGG
TQALYDWNGVNQGNANGNHQAVVPDGQLCGAGKALFKGLNLARSDWPSTAIAPDASGNFQ
FVYKASAPHATRYFDFYITKDGYNPEKPLAWSDLEPAPFCSITSVKLENGTYRMNCPLPQ
GKTGKHVIYNVWQRSDSPEAFYACIDVSFSGAVANPWQALGNLRAQQDLPAGATVTLRLF
DAQGRDAQRHSLTLAQGNNGAKQWPLALAQKVNQDSTLVNVGVLDAYGAVSPVASSQDNQ
VYVRQAGYRFQVDIELPVEGGGEQPGGDGKVDFDYPQGLQQYDAGTVVRGADGKRYQCKP
YPNSGWCKGWDLYYAPGKGMAWQDAWTLL
Download sequence
Identical sequences A0A0C6F3U4 A0A0E1AXS0 A0A1C7BMF0 W1MNP4
WP_003109418.1.100476 WP_003109418.1.101269 WP_003109418.1.101340 WP_003109418.1.10202 WP_003109418.1.10228 WP_003109418.1.10435 WP_003109418.1.10764 WP_003109418.1.11854 WP_003109418.1.12081 WP_003109418.1.12200 WP_003109418.1.1238 WP_003109418.1.12400 WP_003109418.1.12547 WP_003109418.1.12561 WP_003109418.1.12922 WP_003109418.1.12930 WP_003109418.1.13041 WP_003109418.1.13092 WP_003109418.1.13266 WP_003109418.1.13270 WP_003109418.1.13533 WP_003109418.1.1393 WP_003109418.1.14476 WP_003109418.1.14525 WP_003109418.1.14615 WP_003109418.1.14797 WP_003109418.1.14815 WP_003109418.1.14966 WP_003109418.1.14981 WP_003109418.1.1516 WP_003109418.1.15328 WP_003109418.1.15606 WP_003109418.1.15934 WP_003109418.1.16788 WP_003109418.1.16801 WP_003109418.1.1704 WP_003109418.1.172 WP_003109418.1.1758 WP_003109418.1.1761 WP_003109418.1.18054 WP_003109418.1.18349 WP_003109418.1.18795 WP_003109418.1.18892 WP_003109418.1.19711 WP_003109418.1.19718 WP_003109418.1.19741 WP_003109418.1.19824 WP_003109418.1.19930 WP_003109418.1.20154 WP_003109418.1.20692 WP_003109418.1.21096 WP_003109418.1.21209 WP_003109418.1.21253 WP_003109418.1.21801 WP_003109418.1.22316 WP_003109418.1.22389 WP_003109418.1.22390 WP_003109418.1.23191 WP_003109418.1.23264 WP_003109418.1.2355 WP_003109418.1.23938 WP_003109418.1.24183 WP_003109418.1.24234 WP_003109418.1.24319 WP_003109418.1.24626 WP_003109418.1.24662 WP_003109418.1.24940 WP_003109418.1.25675 WP_003109418.1.26010 WP_003109418.1.26473 WP_003109418.1.26553 WP_003109418.1.26681 WP_003109418.1.26682 WP_003109418.1.26705 WP_003109418.1.26862 WP_003109418.1.26967 WP_003109418.1.2698 WP_003109418.1.27039 WP_003109418.1.27073 WP_003109418.1.27687 WP_003109418.1.27772 WP_003109418.1.27825 WP_003109418.1.27933 WP_003109418.1.28078 WP_003109418.1.28193 WP_003109418.1.28505 WP_003109418.1.28699 WP_003109418.1.28713 WP_003109418.1.29003 WP_003109418.1.29127 WP_003109418.1.29401 WP_003109418.1.29440 WP_003109418.1.29633 WP_003109418.1.29958 WP_003109418.1.29973 WP_003109418.1.30120 WP_003109418.1.30693 WP_003109418.1.30943 WP_003109418.1.31587 WP_003109418.1.3172 WP_003109418.1.31732 WP_003109418.1.31741 WP_003109418.1.31848 WP_003109418.1.32637 WP_003109418.1.32998 WP_003109418.1.33009 WP_003109418.1.33097 WP_003109418.1.3351 WP_003109418.1.33521 WP_003109418.1.33547 WP_003109418.1.33549 WP_003109418.1.33669 WP_003109418.1.3385 WP_003109418.1.34143 WP_003109418.1.34203 WP_003109418.1.34306 WP_003109418.1.3436 WP_003109418.1.34461 WP_003109418.1.34583 WP_003109418.1.34670 WP_003109418.1.34876 WP_003109418.1.35036 WP_003109418.1.36148 WP_003109418.1.36608 WP_003109418.1.36708 WP_003109418.1.3672 WP_003109418.1.36756 WP_003109418.1.36879 WP_003109418.1.37050 WP_003109418.1.37125 WP_003109418.1.37172 WP_003109418.1.37416 WP_003109418.1.37698 WP_003109418.1.3773 WP_003109418.1.3818 WP_003109418.1.38505 WP_003109418.1.38510 WP_003109418.1.38582 WP_003109418.1.38587 WP_003109418.1.3887 WP_003109418.1.38932 WP_003109418.1.39458 WP_003109418.1.39537 WP_003109418.1.40115 WP_003109418.1.40207 WP_003109418.1.40237 WP_003109418.1.40874 WP_003109418.1.41290 WP_003109418.1.41412 WP_003109418.1.41487 WP_003109418.1.41692 WP_003109418.1.41703 WP_003109418.1.41725 WP_003109418.1.4196 WP_003109418.1.42 WP_003109418.1.42047 WP_003109418.1.42381 WP_003109418.1.42388 WP_003109418.1.42411 WP_003109418.1.42463 WP_003109418.1.42946 WP_003109418.1.43022 WP_003109418.1.43245 WP_003109418.1.43315 WP_003109418.1.43696 WP_003109418.1.43729 WP_003109418.1.44565 WP_003109418.1.45298 WP_003109418.1.45306 WP_003109418.1.45353 WP_003109418.1.45635 WP_003109418.1.45636 WP_003109418.1.45678 WP_003109418.1.45723 WP_003109418.1.45837 WP_003109418.1.46010 WP_003109418.1.46633 WP_003109418.1.46935 WP_003109418.1.4699 WP_003109418.1.47314 WP_003109418.1.47374 WP_003109418.1.47527 WP_003109418.1.48487 WP_003109418.1.48576 WP_003109418.1.48810 WP_003109418.1.48961 WP_003109418.1.4913 WP_003109418.1.49184 WP_003109418.1.49244 WP_003109418.1.49922 WP_003109418.1.50232 WP_003109418.1.50459 WP_003109418.1.50783 WP_003109418.1.50814 WP_003109418.1.50922 WP_003109418.1.51035 WP_003109418.1.51173 WP_003109418.1.51273 WP_003109418.1.51472 WP_003109418.1.51733 WP_003109418.1.51917 WP_003109418.1.51928 WP_003109418.1.52212 WP_003109418.1.52409 WP_003109418.1.52790 WP_003109418.1.53038 WP_003109418.1.53072 WP_003109418.1.53267 WP_003109418.1.53351 WP_003109418.1.53414 WP_003109418.1.53486 WP_003109418.1.53528 WP_003109418.1.53678 WP_003109418.1.5388 WP_003109418.1.53951 WP_003109418.1.5399 WP_003109418.1.54003 WP_003109418.1.54354 WP_003109418.1.55445 WP_003109418.1.55976 WP_003109418.1.56864 WP_003109418.1.56896 WP_003109418.1.57339 WP_003109418.1.57417 WP_003109418.1.57477 WP_003109418.1.57792 WP_003109418.1.57841 WP_003109418.1.57853 WP_003109418.1.57966 WP_003109418.1.58417 WP_003109418.1.5850 WP_003109418.1.5856 WP_003109418.1.5869 WP_003109418.1.58838 WP_003109418.1.58845 WP_003109418.1.59156 WP_003109418.1.59212 WP_003109418.1.59288 WP_003109418.1.59376 WP_003109418.1.60062 WP_003109418.1.60079 WP_003109418.1.60364 WP_003109418.1.60396 WP_003109418.1.60509 WP_003109418.1.60850 WP_003109418.1.60970 WP_003109418.1.61122 WP_003109418.1.61269 WP_003109418.1.61288 WP_003109418.1.61294 WP_003109418.1.626 WP_003109418.1.62708 WP_003109418.1.62977 WP_003109418.1.63401 WP_003109418.1.63784 WP_003109418.1.64212 WP_003109418.1.6450 WP_003109418.1.64748 WP_003109418.1.65009 WP_003109418.1.65337 WP_003109418.1.65679 WP_003109418.1.65779 WP_003109418.1.6589 WP_003109418.1.6627 WP_003109418.1.66277 WP_003109418.1.6629 WP_003109418.1.66371 WP_003109418.1.66563 WP_003109418.1.6768 WP_003109418.1.67875 WP_003109418.1.67899 WP_003109418.1.67937 WP_003109418.1.67948 WP_003109418.1.68194 WP_003109418.1.68472 WP_003109418.1.68541 WP_003109418.1.68790 WP_003109418.1.68802 WP_003109418.1.68881 WP_003109418.1.6911 WP_003109418.1.69209 WP_003109418.1.69411 WP_003109418.1.70138 WP_003109418.1.70168 WP_003109418.1.70583 WP_003109418.1.70677 WP_003109418.1.71203 WP_003109418.1.71234 WP_003109418.1.71254 WP_003109418.1.71346 WP_003109418.1.71412 WP_003109418.1.71738 WP_003109418.1.71822 WP_003109418.1.71862 WP_003109418.1.71866 WP_003109418.1.72183 WP_003109418.1.72477 WP_003109418.1.72570 WP_003109418.1.72727 WP_003109418.1.7308 WP_003109418.1.73192 WP_003109418.1.73490 WP_003109418.1.73719 WP_003109418.1.7377 WP_003109418.1.73791 WP_003109418.1.74 WP_003109418.1.74475 WP_003109418.1.7448 WP_003109418.1.74637 WP_003109418.1.74878 WP_003109418.1.74941 WP_003109418.1.74958 WP_003109418.1.75119 WP_003109418.1.75303 WP_003109418.1.75580 WP_003109418.1.75792 WP_003109418.1.75938 WP_003109418.1.76861 WP_003109418.1.77238 WP_003109418.1.77476 WP_003109418.1.77574 WP_003109418.1.77913 WP_003109418.1.78104 WP_003109418.1.78148 WP_003109418.1.7840 WP_003109418.1.78425 WP_003109418.1.78810 WP_003109418.1.7899 WP_003109418.1.79007 WP_003109418.1.79286 WP_003109418.1.79421 WP_003109418.1.79699 WP_003109418.1.79883 WP_003109418.1.79902 WP_003109418.1.8 WP_003109418.1.80068 WP_003109418.1.80087 WP_003109418.1.8013 WP_003109418.1.80258 WP_003109418.1.80454 WP_003109418.1.80632 WP_003109418.1.80645 WP_003109418.1.80892 WP_003109418.1.80910 WP_003109418.1.81081 WP_003109418.1.81237 WP_003109418.1.81368 WP_003109418.1.81380 WP_003109418.1.81487 WP_003109418.1.81816 WP_003109418.1.8238 WP_003109418.1.83267 WP_003109418.1.83317 WP_003109418.1.83374 WP_003109418.1.84138 WP_003109418.1.84178 WP_003109418.1.84526 WP_003109418.1.84684 WP_003109418.1.85311 WP_003109418.1.85453 WP_003109418.1.85788 WP_003109418.1.86002 WP_003109418.1.86182 WP_003109418.1.865 WP_003109418.1.86554 WP_003109418.1.86785 WP_003109418.1.86813 WP_003109418.1.86822 WP_003109418.1.8693 WP_003109418.1.87104 WP_003109418.1.8727 WP_003109418.1.87463 WP_003109418.1.87877 WP_003109418.1.87987 WP_003109418.1.88680 WP_003109418.1.889 WP_003109418.1.89330 WP_003109418.1.89523 WP_003109418.1.89867 WP_003109418.1.89871 WP_003109418.1.89992 WP_003109418.1.90189 WP_003109418.1.90770 WP_003109418.1.91204 WP_003109418.1.91281 WP_003109418.1.91307 WP_003109418.1.91467 WP_003109418.1.91527 WP_003109418.1.91796 WP_003109418.1.91943 WP_003109418.1.92043 WP_003109418.1.9219 WP_003109418.1.92594 WP_003109418.1.92759 WP_003109418.1.93122 WP_003109418.1.93130 WP_003109418.1.93264 WP_003109418.1.94065 WP_003109418.1.94230 WP_003109418.1.94732 WP_003109418.1.94742 WP_003109418.1.94943 WP_003109418.1.95018 WP_003109418.1.95056 WP_003109418.1.95354 WP_003109418.1.95745 WP_003109418.1.95751 WP_003109418.1.95774 WP_003109418.1.95994 WP_003109418.1.9706 WP_003109418.1.97204 WP_003109418.1.97377 WP_003109418.1.97461 WP_003109418.1.97488 WP_003109418.1.97499 WP_003109418.1.97521 WP_003109418.1.97583 WP_003109418.1.98111 WP_003109418.1.98672 WP_003109418.1.98718 WP_003109418.1.98907 WP_003109418.1.98963 WP_003109418.1.99353 WP_003109418.1.99647 gi|564954188|ref|YP_008886758.1| gi|478480407|ref|YP_007711058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]