SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479185710|ref|YP_007816056.1| from Alistipes shahii WAL 8301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479185710|ref|YP_007816056.1|
Domain Number 1 Region: 191-303
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 9.94e-45
Family Peptidoglycan hydrolase LytM 0.0013
Further Details:      
 
Domain Number 2 Region: 354-398
Classification Level Classification E-value
Superfamily LysM domain 0.00000000209
Family LysM domain 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|479185710|ref|YP_007816056.1|
Domain Number - Region: 122-192
Classification Level Classification E-value
Superfamily POZ domain 0.00879
Family BTB/POZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479185710|ref|YP_007816056.1|
Sequence length 399
Comment Membrane proteins related to metalloendopeptidases [Alistipes shahii WAL 8301]
Sequence
MKKYIFTLIALSMVFTATARKPKNTRTTEAAAREIAAADSLRLVASRQAALIDSLQNLVA
VAEQRDETAESETAAPDPVVDPEQAAADSVAALRLRLRPTKIESIFDTNGLTVLDTLATE
NDAVQVILYSNNSWKYVLNREVAKDSTIFEKYWDTTTLFPYKEVDMSEMPKSVVIDLVDS
LTSYHCPYQGSVHPRGKYGPRRRRQHQGVDLPLKTGDPVYATFCGRVRISQYNRGGYGNL
VIIRHDNGLETYYGHLSERLVEPDQWVEAGQIIGLGGSTGRSTGPHLHFETRYYGQSFDP
ERLIDFKNGTLSRETFLLKKSFFSIYSNAGQDFEDEIANEEQDKKEAAEKAAMKYYKIRS
GDTLGGIARRYGTTVTNICRLNGIKSTTVLRIGRSLRVR
Download sequence
Identical sequences D4IK33
gi|479185710|ref|YP_007816056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]