SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479186416|ref|YP_007816762.1| from Alistipes shahii WAL 8301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479186416|ref|YP_007816762.1|
Domain Number 1 Region: 241-339
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 0.00000000000628
Family Peptidoglycan hydrolase LytM 0.036
Further Details:      
 
Weak hits

Sequence:  gi|479186416|ref|YP_007816762.1|
Domain Number - Region: 19-114
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0262
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479186416|ref|YP_007816762.1|
Sequence length 373
Comment Membrane-bound metallopeptidase [Alistipes shahii WAL 8301]
Sequence
MRPLRILTLAFLLFTLTAAAQTDRRIEEQKRVIAALEKRIATEEQEISKIQKGRTATEER
VRRLARQIDSRNQLLDETEKQARLLRGEIARTDSVAGNLSAKLERDRAQYGEMVREAYRN
YKHNNYLTYIFSSRDFTDVARKITALREVASLRERKLRDIEALTAEVRTEKETLDRRKRS
LDSVTRSLSAQREKLQRDARNAKASIRSMSQKEKTALQRKIAQEQQLDVAIGELRKLTKG
NTEGASFSAKTSGLRLPVTAGRVKRYKENMAEITGPKGAHVISIYDGKVVDVKRNRITNK
YDVYVAHGEYITSYANMGTICVEKGQKVARNAQIGTIGSAVNVMTMETEYKLVFGIYPPN
PGQKMRAEECFRK
Download sequence
Identical sequences A0A1Q6EAQ7 D4IM39
gi|479186416|ref|YP_007816762.1| WP_015546895.1.48748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]