SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479186836|ref|YP_007817182.1| from Alistipes shahii WAL 8301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479186836|ref|YP_007817182.1|
Domain Number 1 Region: 126-375
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.31e-61
Family Peptidoglycan hydrolase LytM 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479186836|ref|YP_007817182.1|
Sequence length 431
Comment Membrane proteins related to metalloendopeptidases [Alistipes shahii WAL 8301]
Sequence
MNGLKITICALLLAAAGACNRTQGPAVEVEDAEEPHNMLYGINADDYRTETGEVGSGETL
GKILNGFGVSALAVDRLDKASKEVFPLRNIRAGHKYTAFIHEDSLYAPHLDYLAYEISVT
DYVVFGFHDDSVSVRKDAKAYTLRRTKKSAVINSSLWGAIMEQQLPYALAAELEDIYQWT
VDFFGIQKGDDFTVIYDERFIDDTVSVGIGRIWGAKFSQGGKEYYAIPFRQGGKIQYWEA
DGASLRKQMLKAPLKYSRISSKFSYARKHPIYKVYRPHTGVDYAAPKGTPVHAVADGTVT
FKGWGGGGGNTLKIKHAGNLMTGYLHLSGYAKGIVKGSRVSQGQLIGYVGSTGASTGPHL
DYRVWKNGTPIDPLKIPSEPAEPIARENRALFEFVRDRITAELNGEVSPEEQITQLDSLV
LPATVQTPDKQ
Download sequence
Identical sequences D4INA9
gi|479186836|ref|YP_007817182.1| WP_015547240.1.48748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]