SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385227744|ref|YP_005787668.1| from Helicobacter pylori SNT49

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385227744|ref|YP_005787668.1|
Domain Number 1 Region: 38-271
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.38e-77
Family Phosphate binding protein-like 0.00000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385227744|ref|YP_005787668.1|
Sequence length 271
Comment outer membrane protein [Helicobacter pylori SNT49]
Sequence
MNAFKRIISVGVIALGLFNLLDAKHHKEKKENHKITRELKVGANPVPHAQILQSVVDDLK
EKGIKLVIVSFTDYVLPNLALNDGSLDANYFQHRPYLDRFNLDRKMHLVGLANIHVEPLR
FYSQKITDIKNLKKGSVIAVPNDPANQGRALILLHKQGIIALKDPSNLYATEFDIVKNPY
NIKIKPLEAALLPKVLGDVDGAIITGNYALQAKLTGALFSEDKDSPYANLIAAREDNAQD
EAIKVLIEALQSEKTRKFILDTYKGAIIPAF
Download sequence
Identical sequences G2MCS0
gi|385227744|ref|YP_005787668.1| WP_000990971.1.42851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]