SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|348589391|ref|YP_004873853.1| from Taylorella asinigenitalis MCE3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|348589391|ref|YP_004873853.1|
Domain Number 1 Region: 3-251
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.92e-65
Family Phosphate binding protein-like 0.00000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|348589391|ref|YP_004873853.1|
Sequence length 260
Comment Lysine-arginine-ornithine-binding periplasmic protein [Taylorella asinigenitalis MCE3]
Sequence
MRSLLLTAGLVLGLASVAQAKDFTELRIGTESGYVPFEYKNEKGELIGFDIEVGNAICEK
LKAKCTWVEQPFDALIPGLQARKFDIIHASITHNEAREKVIDFTDDVYAIPTQLIAKKGS
GIVTEDDLKGKRLGALQGSAQEAYARRVISKKDVKVVSYKEQPQTFIDLKAGRIDAAIVE
KPNANSAFIATPEGADYEFVGQPLEHELLNNRISIGLRKGDKDLKEALDKAIAELRAEGK
IAEIAKKYFKEGELDLLDKK
Download sequence
Identical sequences G4QD13
gi|348589391|ref|YP_004873853.1| WP_014110729.1.32922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]