SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|348589517|ref|YP_004873979.1| from Taylorella asinigenitalis MCE3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|348589517|ref|YP_004873979.1|
Domain Number 1 Region: 37-120,155-263
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000782
Family Phosphate binding protein-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|348589517|ref|YP_004873979.1|
Sequence length 330
Comment TRAP-type C4-dicarboxylate transport system component [Taylorella asinigenitalis MCE3]
Sequence
MKPFFMKALSVVALGCALVSPSFADEPIVIKFSHVVASDTPKGKGADLFKKLAEEKFPGR
VKVETYPNSSLYGDGKEMEALLTGNVQMLAPSLAKFSKYQKKIQIFDLPFLFEDIAAVEK
FQISDKGKELLNSMRDKGIIGLAYWNNDVKHMSANKPLRKPSDARGLKFRVQASDVLDAQ
FKRLTAIPRKMAFAEVYQGLQSGVVDGTENPYSNVYSQKMHEVQKYITETGHAPLGYMVI
TSDKFWSGLPDDIRKGLEEILADVTVKVNQEAQALNQREKDRIIKAGTTEILTLTDAEKD
EWRKAMVPVWKKFEGEIGTDLIEAAQKSNN
Download sequence
Identical sequences G4QDD9
gi|348589517|ref|YP_004873979.1| WP_014110855.1.32922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]