SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|348590418|ref|YP_004874880.1| from Taylorella asinigenitalis MCE3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|348590418|ref|YP_004874880.1|
Domain Number 1 Region: 25-334
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.4e-75
Family Phosphate binding protein-like 0.00000000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|348590418|ref|YP_004874880.1|
Sequence length 337
Comment ferric iron ABC transporter iron-binding protein [Taylorella asinigenitalis MCE3]
Sequence
MNIKNFLKPLVLAVLLGASAAQANEVVNVYTTREPGLLKPILEAFEKDTGIKAETVFVKD
GLAERVESEGDKSPADLLMVVDISQLTNIVDRGLTQAVDSKVLTDIIPAQYRDPNNHWFA
LSLRYRVLYVSKDMPLETFNYEDLADPKYKGRVCIRSGKHPYNATLFGAMIAHNGVEATE
EFLKGVKNNLARKATGGDRNVARDILGGICDLGFANSYYVGKMHADPKQKEWAEAIKVIK
PTFKKTGGTHANISGAAVAKYAPNKENAVKLLEYLVGPNAQEMYAKVNFEHPIRAGVAPD
PIIAAFGEFKADSLPLIEVPKHRKTATEIVEKIGFDN
Download sequence
Identical sequences G4Q9T8
WP_014111752.1.32922 gi|348590418|ref|YP_004874880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]