SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|348590710|ref|YP_004875172.1| from Taylorella asinigenitalis MCE3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|348590710|ref|YP_004875172.1|
Domain Number 1 Region: 92-233
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000102
Family Phosphate binding protein-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|348590710|ref|YP_004875172.1|
Sequence length 332
Comment tricarboxylate transport protein TctC [Taylorella asinigenitalis MCE3]
Sequence
MKLSLKILNSLFVASLGLGTIASTQAADVEPKRPECVAPAKPGGGFDLTCRVAVNGFAQT
KLIDKQIRTVYMPGGVGAVAYNNIISKRADDNNAFVAFSGGSLLNIAQGKFGRYTVEDVR
WLATVGTDYGAIIVNKDSKFQNLGDLINALKADPKTVVFAAGATIGGQDWMTAALTAKQA
GVDYKNMRFVAFEGGGEAATALQGKHVDVLLSGLAEASTLIDGGAPLKILAVFADKRMEG
RLSNIPTAKEQGYDIQWPVIRGFYLPPKVTDEQFKYWEEKFQALYKTPEFKKIQESQGLF
PFEKTGAELDKFVKERTAYYKELADSFGLIKK
Download sequence
Identical sequences G4QA76
WP_014112043.1.32922 gi|348590710|ref|YP_004875172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]