SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337741054|ref|YP_004632782.1| from Oligotropha carboxidovorans OM5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337741054|ref|YP_004632782.1|
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily YccV-like 3.53e-32
Family YccV-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|337741054|ref|YP_004632782.1|
Sequence length 109
Comment hemimethylated DNA-binding region [Oligotropha carboxidovorans OM5]
Sequence
MKVRSTKFHIGQIVRHRVFSFRGVIFDIDGEFNNTEEWWLSIPEELRPEKDQPFYHLLAE
NAESEYIAYVSEQNLLPDETGDPVGHSQVSEIFIKDKTGSYRQRNLSLN
Download sequence
Identical sequences B6JF98
WP_012563343.1.10663 WP_012563343.1.50963 WP_012563343.1.53695 gi|386030071|ref|YP_005950846.1| gi|337741054|ref|YP_004632782.1| 504832.OCAR_6203 gi|337741054|ref|YP_004632782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]