SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337739152|ref|YP_004638432.1| from Oligotropha carboxidovorans OM5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337739152|ref|YP_004638432.1|
Domain Number 1 Region: 85-153
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.83e-42
Family CO dehydrogenase ISP C-domain like 0.0014
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.6e-41
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|337739152|ref|YP_004638432.1|
Sequence length 166
Comment CO-dehydrogenase small chain CoxS [Oligotropha carboxidovorans OM5]
Sequence
MAKAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVK
SCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQEN
PSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEEAAE
Download sequence
Identical sequences P19921
gi|386031678|ref|YP_005945971.1| gi|337739152|ref|YP_004638432.1| 1n62A WP_013913729.1.50963 WP_013913729.1.53695 gi|337739152|ref|YP_004638432.1| gi|337739152|ref|YP_004638432.1|NC_015689 gi|386031678|ref|YP_005945971.1|NC_017536 1n5w_A 1n5w_D 1n60_A 1n60_D 1n61_A 1n61_D 1n62_A 1n62_D 1n63_A 1n63_D 1zxi_A 1zxi_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]