SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337739989|ref|YP_004631717.1| from Oligotropha carboxidovorans OM5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337739989|ref|YP_004631717.1|
Domain Number 1 Region: 187-368
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.03e-52
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000114
Further Details:      
 
Domain Number 2 Region: 374-478
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 2.88e-33
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.000053
Further Details:      
 
Domain Number 3 Region: 101-214
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 6.15e-31
Family CO dehydrogenase ISP C-domain like 0.00016
Further Details:      
 
Domain Number 4 Region: 10-93
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000000133
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|337739989|ref|YP_004631717.1|
Sequence length 499
Comment xanthine dehydrogenase, flavoprotein XdhA [Oligotropha carboxidovorans OM5]
Sequence
MGNSGPRTCIRFILNGHDVVLSDVAASDTLLDYLRLRRGMVGSKEGCAAGDCGACTTLIG
RLRDGRLVYEAVDSCIRLLASIDGCHVVTVEHLTKPDGRLNPIQQAMVDTHGSQCGFCTP
GIVMSLYAMWLASPSPSDATIERTLQGNLCRCTGYEPVMKAARTISHYGSVADDPLKQTY
DEIQTRLDKLHDNRRVEIEHGGSRIILPANVDDLADAIATERNPTIVSGATDVGLWVTKD
MRAISPAIFTGHLDELKRVTENDASITIGAGLTYSEAFAILPKHFPAFSGLLKRIGGEQV
RNMGTIGGNIANGSPIADTPPTLIVLGARLILRKGKSRRTLPLEDFFIDYKVQDRQPGEF
VEAIEIPKLNPASRFAVYKISKRRDEDISSVLGAFHLTLNDANCVETIRIAYGGMAGIPK
RAKAVEDSLLGQPWTEDTVQAAIGNFAKDFAPLTDMRASAEYRMLVAQNLLRRFHAETEG
AGEAVRLVRHPDSEAMHHG
Download sequence
Identical sequences B6JJ75
gi|337739989|ref|YP_004631717.1| gi|337739989|ref|YP_004631717.1| 504832.OCAR_7366 WP_012564495.1.10663 WP_012564495.1.50963 WP_012564495.1.53695 gi|386029007|ref|YP_005949782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]