SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337740516|ref|YP_004632244.1| from Oligotropha carboxidovorans OM5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337740516|ref|YP_004632244.1|
Domain Number 1 Region: 203-350
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.19e-21
Family Aromatic dioxygenase reductase-like 0.012
Further Details:      
 
Domain Number 2 Region: 8-83
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.42e-16
Family 2Fe-2S ferredoxin-related 0.063
Further Details:      
 
Domain Number 3 Region: 107-196
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.000000000000643
Family Ferredoxin reductase FAD-binding domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|337740516|ref|YP_004632244.1|
Sequence length 350
Comment FAD/NAD(P)-dependent oxidoreductase [Oligotropha carboxidovorans OM5]
Sequence
MIAVKVVDRQGQCATFSAESGQRLLQAGLASGVGLPHECATGTCGSCKATVVKGDVRRLW
PEAPGAKALRSANETLLCQSAADVPVELSLRANFIPPYEPAPRETKGELSLVRELTSEVA
LFSIALRDPIVWQPGQFVLVSGLGIEGARGYSMTREVADPSRIDLLIRKDPSGRFSTALF
DDLGRSHEVAVFGSLGRATFSCDEGRPFIAMAGGSGIAGILAILNHAMNGGHFSKHQSKL
FFGLRDAASSYLLDEISAAVAASQNNLAVTVAFSNEACSPEFAARYPNINFVDGFVHDVV
RAAMQSGAVPADTNPIFFVAGPPVMVNATMRMLVTECKVSPAEIRYDRFG
Download sequence
Identical sequences B6JH21
WP_012563926.1.10663 WP_012563926.1.50963 WP_012563926.1.53695 504832.OCAR_6789 gi|337740516|ref|YP_004632244.1| gi|337740516|ref|YP_004632244.1| gi|386029533|ref|YP_005950308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]