SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337740641|ref|YP_004632369.1| from Oligotropha carboxidovorans OM5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337740641|ref|YP_004632369.1|
Domain Number 1 Region: 225-521
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.91e-50
Family CoA transferase alpha subunit-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|337740641|ref|YP_004632369.1|
Sequence length 612
Comment hypothetical protein OCA5_c14120 [Oligotropha carboxidovorans OM5]
Sequence
MSTVYADPRELADAILRECGRELVVGLPLGLGKANHIANALCERAAQDDAIRLTIFTALT
LEKPAPKSDLERRFIGPVIERLFGGYPDLLYAKWLRAGTLPKNIEVTEFFFLAGRWLRHG
YAQQHYIAANYTHAVAGMLTRGLNVVLQLVAKRVVDGEVRYSLSCNTDTTLDLLKARAEG
KIDFKLIGQVNSELPFMPGPGDLPAFEFHAILDSTETDFAPFAPPSEPVGEAKYAIGLHA
ASLIEDGGTLQIGIGQVGDALAQGLIVRDRHNADFRAAIDRLAPGVSGRACAPFEEGLHG
LSEMFFEAFLGLIEAGIVRREVDGAALHAAFFLGPKSFYRALREMPPDRLDRIRMMPVSF
TNALYGDEDRKRRGRPKARFVNNAMMVTLLGEAVSDGLSNGQVVSGVGGQYDFVAQAFAL
EGARSILTLEATRHNGKRLESNIRWSYDHTTIPRHLRDIVVTEYGVAELRGKSDAEVIAA
MLCVADSRFQDDLMRQAKDAGKLPQAYDIPQAFRDNTPERIARALAPLRDKSLLPQFPFG
TDFTGVEQRLIPALQRLKEVSASPAALLTLGWRGLSADDADDAECLARMKLDAPATLRER
VYRLLLRGALRP
Download sequence
Identical sequences B6JG54
WP_012563792.1.10663 WP_012563792.1.50963 WP_012563792.1.53695 gi|386029658|ref|YP_005950433.1| gi|337740641|ref|YP_004632369.1| gi|337740641|ref|YP_004632369.1| 504832.OCAR_6654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]