SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337740975|ref|YP_004632703.1| from Oligotropha carboxidovorans OM5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337740975|ref|YP_004632703.1|
Domain Number 1 Region: 144-334
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.82e-68
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000521
Further Details:      
 
Domain Number 2 Region: 329-463
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.97e-43
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000246
Further Details:      
 
Domain Number 3 Region: 1-97
Classification Level Classification E-value
Superfamily Single hybrid motif 1.44e-28
Family Biotinyl/lipoyl-carrier proteins and domains 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|337740975|ref|YP_004632703.1|
Sequence length 467
Comment pyruvate dehydrogenase E1 component subunit beta [Oligotropha carboxidovorans OM5]
Sequence
MPIQVLMPALSPTMEKGNLAKWLKKEGDAIRSGDVIAEIETDKATMEVEATDEGTLGKIL
VPEGTADVAVNTPIATILADGESAADLDKAAAPAAQPKAAESAPPAAAPAAVPVPASKAE
AVPAAPASQAAPDPDIPPGTEMVTMTVRDALRDAIAEEMRRDEDVFIMGEEVAEYQGAYK
ITQGILQEFSARRVIDTPITEHGFAGVGIGAAMAGLKPIVEFMTFNFAMQAMDQIINSAA
KTLYMSGGQMGCSIVFRGPNGSAARVAAQHSQDYAAWYSQIPGLKVIAPYTAADAKGLLK
AAIRDPNPVIFLEHEILYGHSFEVPKLDDYVLPIGKARIARTGQHVTLISWSHAMTWTLK
AAEELAKEGIEAEVIDLRTIRPMDTETLIASVQKTGRAVVIEEGWQQSGVGSEVAARLME
HAFDYLDAPVARVSGKDVPMPYAANLEKLALPSVEDVVAAAKAVSYR
Download sequence
Identical sequences B6JFX5
WP_012563424.1.10663 WP_012563424.1.50963 WP_012563424.1.53695 gi|386029992|ref|YP_005950767.1| 504832.OCAR_6285 gi|337740975|ref|YP_004632703.1| gi|337740975|ref|YP_004632703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]