SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384888811|ref|YP_005763113.1| from Helicobacter pylori v225d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384888811|ref|YP_005763113.1|
Domain Number 1 Region: 1-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.28e-69
Family Phosphate binding protein-like 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384888811|ref|YP_005763113.1|
Sequence length 287
Comment hypothetical protein HPV225_0167 [Helicobacter pylori v225d]
Sequence
MISVAHSPDADDIFMYYAIKFGWVDCPIKNKAFHNIALDIETLNQEALKNTYDVSAISFG
LYPKIANDYALLPTATSFGNGYGPKLVKKKGVKLKKDFRVALSGEHTTNALLFKIYYKHA
RITYMNFLDIEKAVLEEKVHAGVLIHENILDFHNELEVEKELWDVWQELIKVDLPLPLGG
MAIRRSIPLYRAILIKKALIKAVEVALKHQNLLSGMLLERSLIRVNKECLQTYLSLYANE
TSTRLSEIQILAIDKLFELGYQHGFYASLLKAKDCLLTDEYLQYRFS
Download sequence
Identical sequences D6XNC0
WP_000626329.1.28590 gi|384888811|ref|YP_005763113.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]