SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387907957|ref|YP_006338291.1| from Helicobacter pylori XZ274

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387907957|ref|YP_006338291.1|
Domain Number 1 Region: 194-396
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 5.23e-16
Family Peptidoglycan hydrolase LytM 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387907957|ref|YP_006338291.1|
Sequence length 400
Comment hypothetical protein MWE_0742 [Helicobacter pylori XZ274]
Sequence
MYKLGVFLLATLLSANTQKVSDIAKDIQHKETLLKKTHEEKNQLNSRLSSLGEAIRSKEL
QKAEMGRQMIALKKSLEKNRNESLAQEKVLTNYRKSLDHLQKQRSFLQKKVFDTLLQDFL
FSQALKRQNLASSNDVILQVAFENLHQSTLSKMSQLSQEEKDLNAQALKVKSSIQKISSV
IDEQKTREVTLKSLQTEQDKLILSMQKDYAIYNQRLTLLEKERQNLNALLKRLNIIKQNR
ENEEKVSLKKSSQALEVKQVASSYQNINTTSYNGPKTIAPLNDYEVVQKFGPYIDPVYNL
KIFSESITLVSKTPNALVRNVLDGKIVFAKEINMLKKVVIIEHKNGIRTIYSQLDKIAPT
IKSGMRIQKGYVLGRIDQRLGFEVTMREKHINPLELIARN
Download sequence
Identical sequences I2DFT4
gi|387907957|ref|YP_006338291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]