SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387908619|ref|YP_006338953.1| from Helicobacter pylori XZ274

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387908619|ref|YP_006338953.1|
Domain Number 1 Region: 9-323
Classification Level Classification E-value
Superfamily SIS domain 7.34e-56
Family mono-SIS domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387908619|ref|YP_006338953.1|
Sequence length 327
Comment polysialic acid capsule expression protein (KpsF) [Helicobacter pylori XZ274]
Sequence
MPLDYNAIAAQVLRDEASALLESVKQFQKPNDLEAIVKLILKSQEKGGKLVIVGVGKSAL
VAQKIVASMLSTGNKSAFLHPTEAMHGDLGMVEKNDVVLMISYGGESLELLNLVSHLKRL
SHKIITFTKSPNSSLSKLGDYYLSLKIKKEACPINTAPTTSTTLTLALGDVLMACLMRAK
NFSQEDFASFHPGGLLGKKLFVKVKDLLQTTNLPLIAPSTSFKDALIEMSEKRLGSAILV
NEANELVGILSDGDVRRALLKGLDLKSEVKRFATLKPKSFKNLDALLLEALEFLECHKIQ
LLVCVDDHNKVLGVLHLHQLLELGLKA
Download sequence
Identical sequences I2DHP6
gi|387908619|ref|YP_006338953.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]