SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288817364|ref|YP_003431711.1| from Hydrogenobacter thermophilus TK-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288817364|ref|YP_003431711.1|
Domain Number 1 Region: 205-385
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.92e-65
Family B3/B4 domain of PheRS, PheT 0.0000142
Further Details:      
 
Domain Number 2 Region: 461-664
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.46e-35
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00017
Further Details:      
 
Domain Number 3 Region: 36-188
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.14e-29
Family Myf domain 0.0019
Further Details:      
 
Domain Number 4 Region: 674-771
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.27e-27
Family Anticodon-binding domain of PheRS 0.0014
Further Details:      
 
Domain Number 5 Region: 396-469
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000119
Family Domains B1 and B5 of PheRS-beta, PheT 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288817364|ref|YP_003431711.1|
Sequence length 771
Comment phenylalanyl-tRNA synthetase beta chain [Hydrogenobacter thermophilus TK-6]
Sequence
MKVPYTWLIELVDVQDISPEDIARELTLKSVETSVQKFDADLDGVVFGKVVEMREHPTKK
NLLVCRLDVGGGYHPTVITGDRSLKLGDGVFLALPGAKVGELCITKREFDGVVSEGMLLS
AQELGLEPHSEGVLKIWEEIKPGTSAYDLLGFGEYLLELEITPNRGDLLSVRGVAREVCA
IFRRNLKKDKEVSFEEFGELDIQIIDRDCKRYRGALIEGVSVKDSPLWLRRRLWQCGVRS
INNVVDITNYIMLRDGQPLHAFDADKLSGGIRVRSAKKGERIALLTGAEKTLTEDNLVIA
DEEKPLAVAGVVGGQESGVNHSSRRILLESAYFEPYRVRRSSKAISTQTDSSYRFERNVD
IEGVKRYQDLAIELILEVAGGTLTALRDAYPSPYQPKTIFLSLEKYRRYAGETLNREEAS
EILTKLGIPNSPMRCGVEVYVPSHRSYDMQRDVDIIEEILRIKGYNSLPSEVLSLPSLPF
EHKSITDKVRELLKSRGLLEIISFSFEDLSLYELLDIEKPTISITNPLVKNQAYMRTSLI
PSLLRTCLYNQRQHNYDMALFEVGRVYTHQGEEERVGILLTGVRRLYPQEVYTAYDALSL
LIDVGRILGLKMESQSSSYGFLHPYVQTDLVLENEKVGFVGQLSPRIVNTLELKGKVFIG
ELRLLHIQQKTKLYKPFSKYPPVIRDLSVVVDKGVAVDKLISHTQNLLKEKLEEVKVFSI
YTGSELGEGKKSVSFRLVFRSFEGSMSDGEVNGLVNKLISSLEDSFGARLR
Download sequence
Identical sequences D3DFA8
gi|288817364|ref|YP_003431711.1| gi|288817364|ref|YP_003431711.1| WP_012962693.1.15338 WP_012962693.1.18459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]