SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288817894|ref|YP_003432241.1| from Hydrogenobacter thermophilus TK-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288817894|ref|YP_003432241.1|
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily PEBP-like 8.77e-55
Family Prokaryotic PEBP-like proteins 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288817894|ref|YP_003432241.1|
Sequence length 153
Comment hypothetical protein HTH_0578 [Hydrogenobacter thermophilus TK-6]
Sequence
MKVESPSFKNGEVIPQKYTCDGENVSPPIAWSGFPEGTKSFVLIVDDPDAPIGTFTHWVV
YDIPANTVSLKENFPKSKQVDNIKQGINDFGRVGYGGPCPPPGHGYHRYFFKVYALNVES
LGLPPGATKEQVESRMKSHILSEGQMMGRYRRD
Download sequence
Identical sequences D3DGT8
WP_012963222.1.15338 WP_012963222.1.18459 gi|288817894|ref|YP_003432241.1| gi|288817894|ref|YP_003432241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]