SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288818031|ref|YP_003432378.1| from Hydrogenobacter thermophilus TK-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288818031|ref|YP_003432378.1|
Domain Number 1 Region: 83-175
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.04e-32
Family Ribosomal protein L6 0.0000946
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.23e-27
Family Ribosomal protein L6 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288818031|ref|YP_003432378.1|
Sequence length 181
Comment 50S ribosomal protein L6 [Hydrogenobacter thermophilus TK-6]
Sequence
MSRIGKKPIEIPKNVKVSLQDGVITVEGPKGKLSMKHHPDMKVYLEESFIKVERPSDDPF
HRAMHGTTAALIRNMIKGVTEGYTVVLEVFGLGYRAAVKGTNLELNLGLSHPVVFPIPPD
VKIEVKENKIYVSGIDKQRVGQVAAQIRAFREPDAYKGKGIRYEGEVLKLKPGKAAGKGK
K
Download sequence
Identical sequences D3DH75
WP_012963359.1.15338 WP_012963359.1.18459 gi|288818031|ref|YP_003432378.1| gi|288818031|ref|YP_003432378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]