SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288818531|ref|YP_003432879.1| from Hydrogenobacter thermophilus TK-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288818531|ref|YP_003432879.1|
Domain Number 1 Region: 23-175
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 2.25e-26
Family MJ1460-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288818531|ref|YP_003432879.1|
Sequence length 196
Comment hypothetical protein HTH_1224 [Hydrogenobacter thermophilus TK-6]
Sequence
MVSFLHKKGKGQQEAQTMDELEAVSKIRVFLKDEGFIVPKKPVQEFYSSIIKLSGFGVGG
ILNMSGRKAGNIAGQIIKELIGNHEPSIEEIELYLRVFLSEAGICEITRWENQEKQVKIY
AKNSVFAEEQESSKPVCIPLQGALAGCFEELTGKEWDCKETQCQAQKKEECIFELWFYHR
SSFSYEQTQDRSCGGG
Download sequence
Identical sequences D3DIM6
gi|288818531|ref|YP_003432879.1| gi|288818531|ref|YP_003432879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]