SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288818022|ref|YP_003432369.1| from Hydrogenobacter thermophilus TK-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288818022|ref|YP_003432369.1|
Domain Number 1 Region: 7-174,857-953
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.29e-23
Family ABC transporter ATPase domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 578-680,710-796,854-958
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000797
Family ABC transporter ATPase domain-like 0.011
Further Details:      
 
Domain Number 3 Region: 426-523
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0000275
Family Rad50 coiled-coil Zn hook 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288818022|ref|YP_003432369.1|
Sequence length 963
Comment ATP-dependent dsDNA exonuclease C subunit [Hydrogenobacter thermophilus TK-6]
Sequence
MKPILLKLENFTTYKKLQEIDFSDLNFFIIQGRTGAGKTSIIDAMCYALYGKVPRYKGTS
IHEHLLSKGQKRMRVYFEFSVKGKRYAVDRQYEPSKPPMVRFYEGSRLLNLKVREVEDYV
SKLLGMDYETFTKVLVLPQGQFDRFLKPQRPAERREILNRLLGYDEIFERISSIIKETLK
ELEREKGILEAEYESLKSINQTMLEQKEKELKRKQEEFKSIRDQKERLSDELQKAIEKER
LENELSQKTFQLSQLLNKHGEINQKKEKLEKAKRVIIYWPLVREYESILNQKDRIIKEKK
ELQHELIKYSEEIKSVQEEYEKIEEKYKKLDKMREKINHLEIKKEKLNNLESIKRKIYET
NMEISKSEEELQNISNSLTDLNEKLQQQNNYLSDLEEKLKNLEGIEAKYAKAQQLKPMYD
SIPKIDEYIKRIDKDIQQKEIELSEVQSKIRQLEDKLFEEYIHQIRLKLSPGDTCPVCGN
KVENVYMVSLEMRTSVENVKEEIQNLRQKEHKLVELLSEKRTQKNSLIQKKEEIISYTKL
DFQEFQKRYRTLEENYKTFLSLREKEKACREKLQKLKEEKSSKEVELSKLETSIKHSQRL
LAQLQEEEERLLKEIGEPVIDPARSVRRLEDELKNLKEEINSIQKRYEEVSRYLKELSAD
FERIKVQMEGKERQEEELKERLNQLACELYPAFQEFGDLETLKSFYLPEDEIQKLDKEIN
NYERDMESLKRDISLLQERIAGYPKHISKEDLERKVKGLEQIMYKINEEIGFLSRELVDI
KHKIQRREHIEKQLQNISRELWKYETLQRDMRSENFPEFVSRQMLQTITDRASFYLLKFS
SGTYEFKLNEGDLLVIDRSSGHERSVFTLSGGETFLASLSLAFAVSDIVSHNAPLESIFI
DEGFGSLDRETRESLGEFFELIKLNAGRMVGIISHLEDLAEKFDQRVLVEKHGDYSVVKV
KVM
Download sequence
Identical sequences D3DH66
gi|288818022|ref|YP_003432369.1| WP_012963350.1.15338 WP_012963350.1.18459 gi|288818022|ref|YP_003432369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]