SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338739194|ref|YP_004676156.1| from Hyphomicrobium sp. MC1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338739194|ref|YP_004676156.1|
Domain Number 1 Region: 155-284,322-365
Classification Level Classification E-value
Superfamily TPR-like 1.71e-17
Family Tetratricopeptide repeat (TPR) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338739194|ref|YP_004676156.1|
Sequence length 390
Comment cytochrome c-type biogenesis protein CycH [Hyphomicrobium sp. MC1]
Sequence
MVFWILVAVLVAGVTLAIVRPLMRPAEPAGATAGADVAVYKDQLKEITADEARGTLGADE
AESARAEIARRLLRVTQDNSKSTTAAEAAMRNRFIVPISILTCIALPIVSLALYLDYGKP
GMPAQPLSERLAEANATSTPNDLIAKVEQRLREHPEDGRGWDVIAPVYYAMGRYADAADA
YQKAIRLIGEDPKRLQGFANARIRMENGIVPDDARKALQRILVLNPNATEPKIWLALAKE
QDGHLTEAAADYKDLISKAPPDAPWRPVLVERLAKLDPQSAAAFANDKSTANAPAAASGM
PSGPEAGAVMNMKPEDRQAFITQMVDNLAARLKTDGSDANGWVKLIRAYQVLGRHDDAVK
ALNDARVSLKGNQGGLAQVEDLARQLGLGS
Download sequence
Identical sequences F8J7K7
WP_013947988.1.38999 WP_013947988.1.98067 gi|338739194|ref|YP_004676156.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]