SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375254034|ref|YP_005013201.1| from Tannerella forsythia ATCC 43037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375254034|ref|YP_005013201.1|
Domain Number 1 Region: 298-523
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.55e-40
Family ABC transporter ATPase domain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 24-291
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.27e-17
Family DNA repair protein MutS, domain III 0.015
Further Details:      
 
Domain Number 3 Region: 750-823
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000301
Family Smr domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|375254034|ref|YP_005013201.1|
Domain Number - Region: 445-471,545-655
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0144
Family C-terminal domain of PLC-beta 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375254034|ref|YP_005013201.1|
Sequence length 826
Comment MutS2 family protein [Tannerella forsythia ATCC 43037]
Sequence
MTYPENFEHKLGFDKIRGLIGAQCLSPLGKELAEEIRFSADMATVSERLEQTDEFVRILQ
GERPFPANYFIDVRRALNRIRPEGTFIEEAELFDLKRSLQTIGDIAAFFAAADDDEEMNY
PALAALAAGVPVFPALVRQIDGMLDRYGQMKDSASAELARIRREKIATTGSISRNLQSIL
RSAQSEGFVDKDVTPAMRDGRLVIPVTPAFKRRIRGIVHDESATGKTVFIEPEAIVEANN
RIRELESEERREIVRILTEFTDLIRPQIPDMLQSYAFLATMDFIRAKAIFAGQIQAIKPA
LTDRPLLDWREAVHPLLLLSHRRQGKPVVPLDITLDQTGRLLIISGPNAGGKSVCLKTVG
LLQYMLQCGILIPLHEQSKAGIFERLFIDIGDEQSIENDLSTYSSHLTNMKYFVRHGNER
TLLLIDEFGSGTEPLMGGALAEALLERFNRKEMFGIITTHYQNLKQYAEDHEGVLNGAML
YDRHLMQPLFKLSIGHPGSSFAVEIARKIGLPEEVIAEASEKVGSDYIDMDKYLQDIVRD
KRYWENKRQHIRRQEKRLEELTARYEKDLDAVNRQRKEIVQTAKNEAQQIIREANAKIEQ
TIREIKEAQAEKERTRIARQALSEFKETVHQTQEDDARIARKMEKLRERQARRKQPEAVT
EPKVMPAPEEKKLAVGDTVRLKGQTTTGTVIELQGKQAVVAFGMIKSTVKTDQLELVSRS
QLKKEVRNHTFVSAQTADAMHEKKLHFKQEIDVRGMRGNEALQAVTYFVDDAIQIGVSRV
RILHGTGNGILRQLIRQYLSTVPGIQRFQDEHVQFGGAGITVIDLE
Download sequence
Identical sequences G8UJ12
gi|375254034|ref|YP_005013201.1| WP_014223709.1.32324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]