SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375254188|ref|YP_005013355.1| from Tannerella forsythia ATCC 43037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375254188|ref|YP_005013355.1|
Domain Number 1 Region: 220-610
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.42e-73
Family beta-Lactamase/D-ala carboxypeptidase 0.00062
Further Details:      
 
Domain Number 2 Region: 66-263
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 4.05e-16
Family Penicillin binding protein dimerisation domain 0.0086
Further Details:      
 
Domain Number 3 Region: 682-735
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375254188|ref|YP_005013355.1|
Sequence length 736
Comment penicillin-binding protein, transpeptidase domain-containing protein [Tannerella forsythia ATCC 43037]
Sequence
MASFEKEEMEEKESGDGHVLARYLMVMLLLLPVVIGILFFTFKIAFAEKDQWNKVAESQK
KPNRLVNPNRGNIYSADGKLLATSVPRYYLYMDFQASGFQKGTGKSKASIDTFMHSSRNG
IDSLAYRLSRKLKNRSAAGYKAHLLRGLKSKSRQYPVYEGRVSYTDLKEIRQYPFFRLGR
NVSGLYEKEMVQRQKLFGTLASRTIGDIYNEIETGGLSKGKNGLELEYDTLLHGQVGYNS
VMRVGGRWTNVIAQEPVDGLDIQTTIDTHIQDLTEKALVNKLKELDAASGIAVVMEVQTG
EIKAISNMERVRPGVYTETKNHAVADEIEPGSTFKVAAMMVAVEDEICTPGTPIDVGSGT
YTINGRTIRDHNAHRGGYGTITAAQSIWYSSNVGIAKVVLKGYGSHPKKFTDGLKRTGID
ADLRLEIPGAGRAKIRTPESPNWSKLTLPWMSFGYEVQIPPINTLTFFNAIANNGKMVRP
MFVKSVTHNGKEVQSFSTEVIRPSICSPRTLKIIQEMLYNVVNYKDPDGRRDGTGKPAGS
DVVTIAGKTGTAQIAASSTAHNVSFCGYFPYENPKYSCIVVVSRPRNGSPSGGLMAGTIF
KEIAEKTYSYQITLNLRAMTKEAGCVAVPAVKNGDARAAKYVIEELDIHASSKRIASEYA
IYGCSAGKDTLRVRELTVRKGLVPYVVGMGARDAVYALEKSGLRVSLSGRGQVVSQSVAP
GQRVVKGQTVEIVLKD
Download sequence
Identical sequences G8UKG1
gi|375254188|ref|YP_005013355.1| WP_014223863.1.32324 WP_014223863.1.3766 WP_014223863.1.98790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]