SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375254470|ref|YP_005013637.1| from Tannerella forsythia ATCC 43037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375254470|ref|YP_005013637.1|
Domain Number 1 Region: 267-564
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.1e-87
Family DNA repair protein MutS, domain III 0.00000112
Further Details:      
 
Domain Number 2 Region: 566-801
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.76e-55
Family ABC transporter ATPase domain-like 0.00000107
Further Details:      
 
Domain Number 3 Region: 7-112
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 9.02e-39
Family DNA repair protein MutS, domain I 0.000058
Further Details:      
 
Domain Number 4 Region: 113-266
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 2.88e-38
Family DNA repair protein MutS, domain II 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375254470|ref|YP_005013637.1|
Sequence length 870
Comment DNA mismatch repair protein MutS [Tannerella forsythia ATCC 43037]
Sequence
MSKIVETPLMKQYFDIKSKHPDAILLFRVGDFYEMYGEDAVAGADILGIVQTKRANGAAQ
YVEMAGFPHHALDTYLPKLVRAGRRVAICDQLEDPKLTKKLVKRGVTELVTPGVSINDNV
LDHRENNFLAAVHFGKSLCGVAFLDISTGEFLTAEGTPETIDKLLTNFAPKEVLVKRGLR
SRFAETFGSRYCLFEQDDWVFTSSTADERLLKHFETVSLKGFGVADLSQGIVAAGAILIY
LDQTKHTQVAHISTLSRIEEDRYVRLDKFTVHSLELVQTMNEGGISLLDILDRTTSPMGA
RLLRRWLLFPLKDLDAIRRRQDTVEYFFRHPDDKDELCRLLGEIGDLERIISKVAVGRVS
PREVVQLKTALQAIAPIREICLNGNEPSLQAFGEQLDPCAAISERIAKEICNDPPALVNK
GGIMAHGVSSELDELRQLSYSGKDYLMRVQQRESERTGIPSLKIAFNNVFGYYIEVRNTH
KDKVPPEWIRKQTLVNAERYITEELKEYEEKILGAEEKILSLEMQLFNELVAELTNYIRP
IQQDAHVIAQLDCLLSFAQTAQSNRYIRPVVDDSDVIDIKGGRHPVIEQQLPAGEPYVAN
DVYLDKKQQQILMITGPNMAGKSALLRQTALITLMAQIGSFVSADSVRIGRVDKIFTRVG
ASDNISVGESTFMVEMNEAANILNNLSPRSLVLFDELGRGTSTYDGISIAWAIVEYIHEQ
PQAAARTLFATHYHELNEMERSFKRIRNFNVSVKESGKKVIFLRKLTPGGSEHSFGIHVA
KMAGMPKSIVKRSNEILKQMEASNGQNGASAKPVRGFASGGEGYQLSFFQLDDPVLGQVR
DEIKNLDVNNLTPLEALNKLSEIKRIIQVK
Download sequence
Identical sequences G8UMY4
WP_014224144.1.32324 gi|375254470|ref|YP_005013637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]