SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375256254|ref|YP_005015421.1| from Tannerella forsythia ATCC 43037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375256254|ref|YP_005015421.1|
Domain Number 1 Region: 384-598
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.31e-28
Family ABC transporter ATPase domain-like 0.0007
Further Details:      
 
Domain Number 2 Region: 128-381
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.000000000000275
Family DNA repair protein MutS, domain III 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375256254|ref|YP_005015421.1|
Sequence length 601
Comment MutS domain V protein [Tannerella forsythia ATCC 43037]
Sequence
MMEEVIRFYDEQITKYTAIRQRLKRRMYHVGTLRLFLFVTALIILWFFRETGWMTLTAWT
TAFALPFVALLVYHTKLSEKKAYAEGMIRLNTDEKKALNYDFSAFEGAPEQIDTQHPFTL
DLDVFGTQSLFQSINRTVTSIGQSCLAEWFMYPLEEKGEILIRQQAVRELTGKVAFRQDF
YVTGITCKGHHDDLTQLKTLTGQAAEASSFGTVWRAMLWLVPSAWLAIIVGIGFGWLPVW
TAGAMVALGFLIANLPGRKIHQLCRSIDKMEQLLRAYSQLIGKIERETFDAPLLTSLQQH
FVSEKTSASRAIRRMSRIIGALDQRYSTIGIILNLLYLRDMRQVMLMEQWLRTHSTHFGL
WFEALAQTDALCSLGGFAFNHPDYPYPAIAETYFVMEGEALGHPLLHREKCIRNDVCISK
HPYFMVVTGANMAGKSTYLRTIGVNFLLACMGMPVCARSLTVYPARPVTSLRTADSLAAN
ESYFFAELKRLKMIIDRLNAGEKLFIILDEILKGTNSKDKQKGSLALMKQLIAKEACGII
ATHDLLLGTLEDEFPHDIKNYRFEADITDNTLTFSYRMREGVARNMNASFLMKKMGITLS
E
Download sequence
Identical sequences A0A1D3UUX5 G8UMS2
gi|375256254|ref|YP_005015421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]