SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375256745|ref|YP_005015912.1| from Tannerella forsythia ATCC 43037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375256745|ref|YP_005015912.1|
Domain Number 1 Region: 49-111
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000458
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375256745|ref|YP_005015912.1|
Sequence length 222
Comment PASTA domain-containing protein [Tannerella forsythia ATCC 43037]
Sequence
MQIDFKNIREQFMRIPIILHVLLIGGVLCLLSALTLQALKGYTLHNQAIIVPDVKGLQLE
EATTFFENNDLHYTVIDSVYTKDVPPGAIYEMVPGAGSKVKEGRIIFVTLNARTAQTASV
PDVADLSFRQAYALLQSKGFTSIEILYVPGRYRDLALGIELRGHLLKPGERVPVAARLVL
KVSDGGSAPDAASGDSIDTSPESSRPRTEETTSSPSENEKWF
Download sequence
Identical sequences G8UIT4
gi|375256745|ref|YP_005015912.1| WP_014226358.1.32324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]