SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385809313|ref|YP_005845709.1| from Ignavibacterium album JCM 16511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385809313|ref|YP_005845709.1|
Domain Number 1 Region: 4-315
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.08e-73
Family Methylenetetrahydrofolate reductase 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385809313|ref|YP_005845709.1|
Sequence length 316
Comment 5,10-Methylenetetrahydrofolate reductase [Ignavibacterium album JCM 16511]
Sequence
MKVIEHLSNARNPLISFEIIPPKRGGDISSILSLLDDLVKYHPPFIDITSHAAEVYYDET
PQGIKKIIKRKRPGTLGICALIQNKYNIDAVPHVLTKGFTREETEDFLIELNYLGIQNVL
AIRGDDSGYNKPIPQGRSANQYAVDLVKQIMDMNRGKYLEDSLLDAKATNFCVGVSGYPE
KHFEAPNLKSDIKFMKEKIDAGAEYIVTQMFYDNKHYFNFVELAREMGVTAPIIPGLKIL
TSKVQLNTIPKNFYINIPEALSDEVLAAKPEHVIDIGVEWAAKQVEELLNKNVPAVHFYI
MQNSKPIIKLMEKIKL
Download sequence
Identical sequences I0AHI4
WP_014559597.1.81480 gi|385809313|ref|YP_005845709.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]