SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385809376|ref|YP_005845772.1| from Ignavibacterium album JCM 16511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385809376|ref|YP_005845772.1|
Domain Number 1 Region: 26-279
Classification Level Classification E-value
Superfamily Folate-binding domain 1.16e-46
Family Aminomethyltransferase folate-binding domain 0.0018
Further Details:      
 
Domain Number 2 Region: 283-365
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0000000000965
Family Aminomethyltransferase beta-barrel domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385809376|ref|YP_005845772.1|
Sequence length 366
Comment GcvT-like aminomethyltransferase [Ignavibacterium album JCM 16511]
Sequence
MFDNTMIPNEILSYFESKGYNIDRNNGTAVIKSFSKPEDEIFSLYNGVGLRHLHSASIIE
LRGQDSADFLHRITTNGLKDFAKEQIRKTIFTTEKGRVIDVVSVLNFESHLILVGDLSNK
LKVMSWINRYVISDDVKQSDANHRFNILEFSGPQADSFMTWVCGSAISDIPVDSFKVMNV
EGILFFLAKMKDERGFKKFWALTDNSHTIRLLNYVLENTGPFDFSLIGEEAYNSFRIEQG
IPAAPNEICDLFNPHELNLSDLIDTKKGCYIGQEVLARLETYDKVQKKLTGLTLESPVEL
HNETQLVDSENQNAGVITSFVNSIKLKKPIGLAVVKKNYLNGESTLFVVDGNSKIEAKIT
SLPFKK
Download sequence
Identical sequences I0AHP7
WP_014559660.1.81480 gi|385809376|ref|YP_005845772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]