SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385810027|ref|YP_005846423.1| from Ignavibacterium album JCM 16511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385810027|ref|YP_005846423.1|
Domain Number 1 Region: 30-294
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.86e-64
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385810027|ref|YP_005846423.1|
Sequence length 301
Comment proline dehydrogenase [Ignavibacterium album JCM 16511]
Sequence
MNILNQLIVSIVQMMPKNIVGFFSRKYIAGETLEDGIKVVKQLNAKGIYATMDVLGEAVK
NKEESIDAKNKAMEVLNAIEKYKLMANLSIKPTQMGLLIDEEFAYQQILDLVKRAHEINN
FVRIDMEDSSTTDMTINLYKRIYQQYKNVGVVIQAYLKRSFDDVVVLNKLGTNYRLCKGI
YVEPASIAIKDRQAIRENYLKILKQMFIDGNYVGIATHDKYLIDEAYKMIREMNIPKDKF
EFQMLLGVREDLRDKINSDGYKIRVYVPFGKDWYAYSVRRLKENPSIAGHIVKSFLTFGK
R
Download sequence
Identical sequences I0AJJ8
WP_014560308.1.81480 gi|385810027|ref|YP_005846423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]