SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385234608|ref|YP_005795950.1| from Ketogulonigenium vulgarum WSH-001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385234608|ref|YP_005795950.1|
Domain Number 1 Region: 7-225
Classification Level Classification E-value
Superfamily Ribosomal protein L1 3.66e-82
Family Ribosomal protein L1 0.000000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385234608|ref|YP_005795950.1|
Sequence length 232
Comment 50S ribosomal protein L1 [Ketogulonicigenium vulgare WSH-001]
Sequence
MAKLGKRTTAAREAFAGKENLALNDAVALVKANATAKFDETIEVALNLGVDPRYADQMVR
GSVNLPNGTGKTVRVAVFARGEKAEQAKAAGADIVGAEDLMEIVQSGKIDFDRCIATPDM
MPIVGRLGKILGPRNLMPNPKIGTVTVDVAEAVEAAKGGQVTFKVEKAGVIHAGVGKASF
GADKLAENIAAFVDAVAKARPTGAKGTYLKKVSLSSTMGPGVSVDVASASGK
Download sequence
Identical sequences E3EZE4 F9Y5M9
gi|310817021|ref|YP_003964985.1| WP_013385334.1.38423 WP_013385334.1.51946 WP_013385334.1.57483 WP_013385334.1.60947 YP_005795950.1.93432 gi|385234608|ref|YP_005795950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]